DHODH Antikörper (AA 132-173)

Produktnummer ABIN5647841

Dieses Anti-DHODH-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von DHODH in WB und IHC (p). Geeignet für Human, Maus und Ratte.

Kurzübersicht für DHODH Antikörper (AA 132-173) (ABIN5647841)

Target: DHODH (Dihydroorotate Dehydrogenase (DHODH))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DHODH Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Produktdetails anti-DHODH Antikörper

Bindungsspezifität: AA 132-173

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 132-173 (RVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTED) from the human protein were used as the immunogen for the DHODH antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Western blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the DHODH antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu DHODH

Target: DHODH (Dihydroorotate Dehydrogenase (DHODH))

Andere Bezeichnung: DHODH

Hintergrund: Dihydroorotate dehydrogenase is an enzyme that in humans is encoded by the DHODH gene on chromosome 16. The protein encoded by this gene catalyzes the fourth enzymatic step, the ubiquinone-mediated oxidation of dihydroorotate to orotate, in de novo pyrimidine biosynthesis. This protein is a mitochondrial protein located on the outer surface of the inner mitochondrial membrane.

UniProt: Q02127

Pathways: Ribonucleoside Biosynthetic Process, Protein targeting to Nucleus