TMEM107 Antikörper (AA 22-57)

Produktnummer ABIN5647748

Dieses Anti-TMEM107-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von TMEM107 in WB und IHC (p). Geeignet für Human.

Kurzübersicht für TMEM107 Antikörper (AA 22-57) (ABIN5647748)

Target: TMEM107 (Transmembrane Protein 107 (TMEM107))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMEM107 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Produktdetails anti-TMEM107 Antikörper

Bindungsspezifität: AA 22-57

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 22-57 (VITLFWSRDSNIQACLPLTFTPEEYDKQDIQLVAAL) from the human protein were used as the immunogen for the TMEM107 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the TMEM107 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the TMEM107 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu TMEM107

Target: TMEM107 (Transmembrane Protein 107 (TMEM107))

Andere Bezeichnung: TMEM107

Hintergrund: Cilia are dynamic signaling organelles essential for developmental patterning, including left-right specification, skeletal formation, neural development, and organogenesis. TMEM107 is predicted to be critical for cilia formation and signaling in a subset of embryonic tissues. Based on an alignment of the TMEM107 sequence with the genomic sequence (GRCh38), the gene was mapped to chromosome 17p13.1.

UniProt: Q6UX40