ASXL1 Antikörper

Produktnummer ABIN5647693

Der Kaninchen Polyklonal Anti-ASXL1-Antikörper wurde für WB validiert. Er ist geeignet, ASXL1 in Proben von Human und Maus zu detektieren.

Kurzübersicht für ASXL1 Antikörper (ABIN5647693)

Target: ASXL1 (Additional Sex Combs Like 1 (ASXL1))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ASXL1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ASXL1 Antikörper

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids KKERTWAEAARLVLENYSDAPMTPKQILQVIEAE were used as the immunogen for the ASXL1 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the ASXL1 antibody should be determined by the researcher.\. Western Blot: 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the ASXL1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu ASXL1

Target: ASXL1 (Additional Sex Combs Like 1 (ASXL1))

Andere Bezeichnung: ASXL1

Hintergrund: Putative Polycomb group protein ASXL1 is a protein that in humans is encoded by the ASXL1 gene. This gene is similar to the Drosophila additional sex combs gene, which encodes a chromatin-binding protein required for normal determination of segment identity in the developing embryo. The protein is a member of the Polycomb group of proteins, which are necessary for the maintenance of stable repression of homeotic and other loci. The protein is thought to disrupt chromatin in localized areas, enhancing transcription of certain genes while repressing the transcription of other genes. The protein encoded by this gene functions as a ligand-dependent co-activator for retinoic acid receptor in cooperation with nuclear receptor coactivator 1. Mutations in this gene are associated with myelodysplastic syndromes and chronic myelomonocytic leukemia. Alternative splicing results in multiple transcript variants.

UniProt: Q8IXJ9

Pathways: Retinoic Acid Receptor Signaling Pathway