LYN Antikörper (AA 470-501)

Produktnummer ABIN5647656

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch LYN in WB und IHC (p). Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für LYN Antikörper (AA 470-501) (ABIN5647656)

Target: LYN (V-Yes-1 Yamaguchi Sarcoma Viral Related Oncogene Homolog (LYN))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LYN Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Produktdetails anti-LYN Antikörper

Bindungsspezifität: AA 470-501

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 470-501 (DELYDIMKMCWKEKAEERPTFDYLQSVLDDFY) were used as the immunogen for the LYN antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the LYN antibody should be determined by the researcher.\. Western Blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the LYN antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu LYN

Target: LYN (V-Yes-1 Yamaguchi Sarcoma Viral Related Oncogene Homolog (LYN))

Andere Bezeichnung: LYN

Hintergrund: Tyrosine-protein kinase Lyn is a protein that in humans is encoded in humans by the LYN gene. It is mapped to 8q12.1. Lyn is a member of the Src family of protein tyrosine kinases. In various hematopoietic cells, Lyn has emerged as a key enzyme involved in the regulation of cell activation.Lyn has been described to have an inhibitory role in myeloid lineage proliferation.

UniProt: P07948

Pathways: Fc-epsilon Rezeptor Signalübertragung, Hormone Transport, Response to Growth Hormone Stimulus, Cellular Response to Molecule of Bacterial Origin, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, CXCR4-mediated Signaling Events, Thromboxane A2 Receptor Signaling, Integrin Complex, BCR Signaling