APC2 Antikörper (AA 51-90)
-
- Target Alle APC2 Antikörper anzeigen
- APC2 (APC Regulator of WNT Signaling Pathway 2 (APC2))
-
Bindungsspezifität
- AA 51-90
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser APC2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Antigen affinity purified
- Immunogen
- Amino acids 51-90 (KHLQGKLEQEARVLVSSGQTEVLEQLKALQMDITSLYNLK) from the human protein were used as the immunogen for the APC2 antibody.
- Isotyp
- IgG
- Top Product
- Discover our top product APC2 Primärantikörper
-
-
- Applikationshinweise
- Western blot: 0.5-1 μg/mL
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Lagerung
- -20 °C
- Informationen zur Lagerung
- After reconstitution, the APC2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Target
- APC2 (APC Regulator of WNT Signaling Pathway 2 (APC2))
- Andere Bezeichnung
- APC2 (APC2 Produkte)
- Synonyme
- APCL antikoerper, AI852447 antikoerper, R75424 antikoerper, APC2, WNT signaling pathway regulator antikoerper, adenomatosis polyposis coli 2 antikoerper, APC2 antikoerper, Apc2 antikoerper
- Hintergrund
- APC2, also called APCL or Adenomatous polyposis coli protein-like, is a deduced 2,303-amino acid protein that contains an N-terminal coiled-coil domain, followed by an armadillo domain and five 20-amino acid repeats. The human APC2 gene is mapped to chromosome 19p13.3. It is found that the 20-amino acid repeat domain of APCL could bind beta-catenin (CTNNB1) and deplete the intracellular beta-catenin pool. A reporter gene assay revealed that APCL could regulate interaction of beta-catenin with T cell-specific transcription factors (TCF7), although less efficiently than APC.
- UniProt
- O95996
- Pathways
- WNT Signalweg
-