APC2 Antikörper (AA 51-90)

Produktnummer ABIN5647467

Produktdetails anti-APC2 Antikörper

Target: APC2 (APC Regulator of WNT Signaling Pathway 2 (APC2))

Bindungsspezifität: AA 51-90

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser APC2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 51-90 (KHLQGKLEQEARVLVSSGQTEVLEQLKALQMDITSLYNLK) from the human protein were used as the immunogen for the APC2 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Western blot: 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the APC2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu APC2

Target: APC2 (APC Regulator of WNT Signaling Pathway 2 (APC2))

Andere Bezeichnung: APC2 (APC2 Produkte)

Hintergrund: APC2, also called APCL or Adenomatous polyposis coli protein-like, is a deduced 2,303-amino acid protein that contains an N-terminal coiled-coil domain, followed by an armadillo domain and five 20-amino acid repeats. The human APC2 gene is mapped to chromosome 19p13.3. It is found that the 20-amino acid repeat domain of APCL could bind beta-catenin (CTNNB1) and deplete the intracellular beta-catenin pool. A reporter gene assay revealed that APCL could regulate interaction of beta-catenin with T cell-specific transcription factors (TCF7), although less efficiently than APC.

UniProt: O95996

Pathways: WNT Signalweg