PIAS4 Antikörper (AA 130-174)

Produktnummer ABIN5647228

Produktdetails anti-PIAS4 Antikörper

Target: PIAS4 (Protein Inhibitor of Activated STAT, 4 (PIAS4))

Bindungsspezifität: AA 130-174

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PIAS4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 130-174 (EVRLVKLPFFNMLDELLKPTELVPQNNEKLQESPCIFALTPRQVE) from the human protein were used as the immunogen for the PIAS4 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Western blot: 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the PIAS4 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu PIAS4

Target: PIAS4 (Protein Inhibitor of Activated STAT, 4 (PIAS4))

Andere Bezeichnung: PIAS4 / PIASg (PIAS4 Produkte)

Hintergrund: Protein inhibitor of activated STAT protein 4 or protein inhibitor of activated STAT protein gamma (PIASg or PIASy), is an enzyme that in humans is encoded by the PIAS4 gene. This gene is mapped to 19p13.3. This gene plays a crucial role as a transcriptional coregulation in various cellular pathways, including the STAT pathway, the p53/TP53 pathway, the Wnt pathway and the steroid hormone signaling pathway. It also functions as an E3-type small ubiquitin-like modifier (SUMO) ligase, stabilizing the interaction between UBE2I and the substrate, and as a SUMO-tethering factor. This gene involved in gene silencing.

UniProt: Q8N2W9

Pathways: JAK-STAT Signalweg, Interferon-gamma Pathway, Positive Regulation of Response to DNA Damage Stimulus