PIAS4 Antikörper (AA 130-174)
Kurzübersicht für PIAS4 Antikörper (AA 130-174) (ABIN5647228)
Target
Alle PIAS4 Antikörper anzeigenReaktivität
Wirt
Klonalität
Konjugat
Applikation
-
-
Bindungsspezifität
- AA 130-174
-
Aufreinigung
- Antigen affinity purified
-
Immunogen
- Amino acids 130-174 (EVRLVKLPFFNMLDELLKPTELVPQNNEKLQESPCIFALTPRQVE) from the human protein were used as the immunogen for the PIAS4 antibody.
-
Isotyp
- IgG
-
-
anti-Protein Inhibitor of Activated STAT, 4 (PIAS4) (AA 48-79), (N-Term) antibody
PIAS4 Reaktivität: Human WB, IHC (p) Wirt: Kaninchen Polyclonal RB0680 unconjugated
anti-Protein Inhibitor of Activated STAT, 4 (PIAS4) (C-Term) antibodyPIAS4 Reaktivität: Human, Maus, Ratte WB, ELISA, IHC, IF, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Protein Inhibitor of Activated STAT, 4 (PIAS4) (AA 471-499), (C-Term) antibodyPIAS4 Reaktivität: Human WB, IHC (p) Wirt: Kaninchen Polyclonal RB00682 unconjugated
anti-Protein Inhibitor of Activated STAT, 4 (PIAS4) (AA 66-241) antibodyPIAS4 Reaktivität: Human ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Protein Inhibitor of Activated STAT, 4 (PIAS4) (AA 44-73), (N-Term) antibodyPIAS4 Reaktivität: Maus WB Wirt: Kaninchen Polyclonal RB33956 unconjugated
anti-Protein Inhibitor of Activated STAT, 4 (PIAS4) (AA 60-260) antibodyPIAS4 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-Protein Inhibitor of Activated STAT, 4 (PIAS4) (AA 1-510) antibodyPIAS4 Reaktivität: Human WB Wirt: Maus Polyclonal unconjugated
anti-Protein Inhibitor of Activated STAT, 4 (PIAS4) (AA 44-60) antibodyPIAS4 Reaktivität: Human, Affe WB, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Protein Inhibitor of Activated STAT, 4 (PIAS4) (N-Term) antibodyPIAS4 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Meerschweinchen, Pferd, Zebrafisch (Danio rerio), Affe, Fledermaus, Huhn, Schwein, Hamster, Xenopus laevis WB Wirt: Kaninchen Polyclonal unconjugated
anti-Protein Inhibitor of Activated STAT, 4 (PIAS4) (C-Term) antibodyPIAS4 Reaktivität: Human, Rind (Kuh) WB, IHC Wirt: Kaninchen Polyclonal unconjugated
-
-
Applikationshinweise
- Western blot: 0.5-1 μg/mL
-
Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
-
-
Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
-
Lagerung
- -20 °C
-
Informationen zur Lagerung
- After reconstitution, the PIAS4 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
-
- PIAS4 (Protein Inhibitor of Activated STAT, 4 (PIAS4))
-
Andere Bezeichnung
- PIAS4 / PIASg
-
Hintergrund
- Protein inhibitor of activated STAT protein 4 or protein inhibitor of activated STAT protein gamma (PIASg or PIASy), is an enzyme that in humans is encoded by the PIAS4 gene. This gene is mapped to 19p13.3. This gene plays a crucial role as a transcriptional coregulation in various cellular pathways, including the STAT pathway, the p53/TP53 pathway, the Wnt pathway and the steroid hormone signaling pathway. It also functions as an E3-type small ubiquitin-like modifier (SUMO) ligase, stabilizing the interaction between UBE2I and the substrate, and as a SUMO-tethering factor. This gene involved in gene silencing.
-
UniProt
- Q8N2W9
-
Pathways
- JAK-STAT Signalweg, Interferon-gamma Pathway, Positive Regulation of Response to DNA Damage Stimulus
Target
-
