PD-1 Antikörper (AA 84-117)

Produktnummer ABIN5647075

Der Kaninchen Polyklonal anti-PD-1 Antikörper wird verwendet zum Nachweis von PD-1 in Proben von Maus und Ratte. Er wurde validiert für FACS, WB, IF und IHC (p).

Kurzübersicht für PD-1 Antikörper (AA 84-117) (ABIN5647075)

Target: PD-1 (PDCD1) (Programmed Cell Death 1 (PDCD1))

Reaktivität: Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PD-1 Antikörper ist unkonjugiert

Applikation: Flow Cytometry (FACS), Western Blotting (WB), Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Produktdetails anti-PD-1 Antikörper

Bindungsspezifität: AA 84-117

Verwendungszweck: PD-1 Antibody / PDCD1

Sequenz: NGLSQPVQDA RFQIIQLPNR HDFHMNILDT RRND

Aufreinigung: Antigen affinity

Immunogen: Amino acids 84-117 (NGLSQPVQDARFQIIQLPNRHDFHMNILDTRRND) from the mouse protein were used as the immunogen for the PD-1 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the PD-1 antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the PD-1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu PD-1

Target: PD-1 (PDCD1) (Programmed Cell Death 1 (PDCD1))

Andere Bezeichnung: PD-1

Hintergrund: PDCD1 (Programmed cell death 1), also called PD1, encodes a cell surface receptor that is a member of the B7 superfamily involved in immunomodulation. This gene is mapped to 2q37.3. PDCD1 acts as an inhibitory molecule on T cells after interacting with its ligands PDL1 and PDL2. The PDCD1 gene contains 5 exons. This protein is expressed in pro-B-cells and is thought to play a role in their differentiation. Using flow cytometric analysis, it has been found that expression of PDCD1 was upregulated on CD16-positive and CD16-negative monocytes, but not on dendritic cells, in viremic HIV-positive patients, but not in highly active antiretroviral therapy (HAART)-treated HIV-positive patients. PDCD1 upregulation in monocytes was induced by microbial Toll-like receptor ligands and inflammatory cytokines.

UniProt: Q02242

Pathways: Cancer Immune Checkpoints