Telefon:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@antikoerper-online.de

Insulin Receptor Antikörper (AA 38-76)

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch Insulin Receptor in WB. Es zeigt Reaktivität gegenüber Proben von Human und Ratte.
Produktnummer ABIN5647071
644,88 €
Zzgl. Versandkosten 20,00 € und MwSt
100 μg
Lieferung nach: Deutschland
Lieferung in 6 bis 9 Werktagen

Kurzübersicht für Insulin Receptor Antikörper (AA 38-76) (ABIN5647071)

Target

Alle Insulin Receptor (INSR) Antikörper anzeigen
Insulin Receptor (INSR)

Reaktivität

  • 208
  • 109
  • 100
  • 16
  • 12
  • 8
  • 7
  • 6
  • 6
  • 6
  • 4
  • 3
  • 2
  • 2
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
Human, Ratte

Wirt

  • 177
  • 43
  • 6
  • 2
  • 1
Kaninchen

Klonalität

  • 145
  • 84
Polyklonal

Konjugat

  • 135
  • 17
  • 16
  • 7
  • 6
  • 5
  • 4
  • 4
  • 4
  • 4
  • 4
  • 4
  • 2
  • 2
  • 2
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
Dieser Insulin Receptor Antikörper ist unkonjugiert

Applikation

  • 157
  • 77
  • 73
  • 33
  • 29
  • 28
  • 22
  • 17
  • 13
  • 13
  • 9
  • 5
  • 5
  • 4
  • 2
  • 2
  • 2
  • 2
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
Western Blotting (WB)
  • Bindungsspezifität

    • 16
    • 13
    • 13
    • 11
    • 8
    • 8
    • 8
    • 5
    • 5
    • 5
    • 5
    • 4
    • 4
    • 4
    • 4
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 38-76

    Aufreinigung

    Antigen affinity purified

    Immunogen

    Amino acids 38-76 (MDIRNNLTRLHELENCSVIEGHLQILLMFKTRPEDFRDL) from the human protein were used as the immunogen for the Insulin Receptor antibody.

    Isotyp

    IgG
  • Applikationshinweise

    Western blot: 0.5-1 μg/mL

    Beschränkungen

    Nur für Forschungszwecke einsetzbar
  • Buffer

    0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

    Lagerung

    -20 °C

    Informationen zur Lagerung

    After reconstitution, the Insulin Receptor antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
  • Target

    Insulin Receptor (INSR)

    Andere Bezeichnung

    Insulin Receptor / INSR

    Hintergrund

    Insulin receptor is a tetramer of 2 alpha and 2 beta subunits that are coded by a single gene and are joined by disulfide bonds, a mechanism parallel to that of its ligand, insulin. It belongs to the large class of tyrosine kinase receptors. The insulin receptor gene is mapped to 19p13.2. The insulin receptor mediates their activity by causing the addition of a phosphate group to particular tyrosines on certain proteins within a cell. The INSR gene spans more than 120 kb and has 22 exons. Functional studies of the INSR SNPs show no effect on mRNA levels or splicing in peripheral blood leukocytes or on binding of insulin to mononuclear cells.

    UniProt

    P06213

    Pathways

    NF-kappaB Signalweg, RTK Signalweg, AMPK Signaling, Carbohydrate Homeostasis, Regulation of Cell Size, Regulation of Carbohydrate Metabolic Process, Growth Factor Binding, Negative Regulation of Transporter Activity
Sie sind hier:
Chat with us!