Insulin Receptor Antikörper (AA 38-76)

Produktnummer ABIN5647071

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch Insulin Receptor in WB. Er zeigt eine Reaktivität gegenüber Human und Ratte.

Kurzübersicht für Insulin Receptor Antikörper (AA 38-76) (ABIN5647071)

Target: Insulin Receptor (INSR)

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Insulin Receptor Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Insulin Receptor Antikörper

Bindungsspezifität: AA 38-76

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 38-76 (MDIRNNLTRLHELENCSVIEGHLQILLMFKTRPEDFRDL) from the human protein were used as the immunogen for the Insulin Receptor antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Western blot: 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the Insulin Receptor antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu Insulin Receptor

Target: Insulin Receptor (INSR)

Andere Bezeichnung: Insulin Receptor / INSR

Hintergrund: Insulin receptor is a tetramer of 2 alpha and 2 beta subunits that are coded by a single gene and are joined by disulfide bonds, a mechanism parallel to that of its ligand, insulin. It belongs to the large class of tyrosine kinase receptors. The insulin receptor gene is mapped to 19p13.2. The insulin receptor mediates their activity by causing the addition of a phosphate group to particular tyrosines on certain proteins within a cell. The INSR gene spans more than 120 kb and has 22 exons. Functional studies of the INSR SNPs show no effect on mRNA levels or splicing in peripheral blood leukocytes or on binding of insulin to mononuclear cells.

UniProt: P06213

Pathways: NF-kappaB Signalweg, RTK Signalweg, AMPK Signaling, Carbohydrate Homeostasis, Regulation of Cell Size, Regulation of Carbohydrate Metabolic Process, Growth Factor Binding, Negative Regulation of Transporter Activity