PD-1 Antikörper (N-Term)

Produktnummer ABIN5518784

Produktdetails anti-PD-1 Antikörper

Target: PD-1 (PDCD1) (Programmed Cell Death 1 (PDCD1))

Bindungsspezifität: AA 84-117, N-Term

Reaktivität: Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PD-1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Programmed cell death protein 1(Pdcd1) detection. Tested with WB, IHC-P in Mouse,Rat.

Sequenz: NGLSQPVQDA RFQIIQLPNR HDFHMNILDT RRND

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Programmed cell death protein 1(Pdcd1) detection. Tested with WB, IHC-P in Mouse,Rat.
Gene Name: programmed cell death 1
Protein Name: Programmed cell death protein 1

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of mouse PD1 (84-117aa NGLSQPVQDARFQIIQLPNRHDFHMNILDTRRND), different from the related human sequence by fifteen amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Rat, Predicted Species: Mouse, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu PD-1

Target: PD-1 (PDCD1) (Programmed Cell Death 1 (PDCD1))

Andere Bezeichnung: Pdcd1 (PDCD1 Produkte)

Synonyme: CD279 antikoerper, PD-1 antikoerper, PD1 antikoerper, SLEB2 antikoerper, hPD-1 antikoerper, hPD-l antikoerper, Ly101 antikoerper, Pdc1 antikoerper, programmed cell death 1 antikoerper, PDCD1 antikoerper, Pdcd1 antikoerper

Hintergrund: PDCD1 (Programmed cell death 1), also called PD1, encodes a cell surface receptor that is a member of the B7 superfamily involved in immunomodulation. This gene is mapped to 2q37.3. PDCD1 acts as an inhibitory molecule on T cells after interacting with its ligands PDL1 and PDL2. The PDCD1 gene contains 5 exons. This protein is expressed in pro-B-cells and is thought to play a role in their differentiation. Using flow cytometric analysis, it has been found that expression of PDCD1 was upregulated on CD16-positive and CD16-negative monocytes, but not on dendritic cells, in viremic HIV-positive patients, but not in highly active antiretroviral therapy (HAART)-treated HIV-positive patients. PDCD1 upregulation in monocytes was induced by microbial Toll-like receptor ligands and inflammatory cytokines.

Synonyms: Programmed cell death protein 1 | Protein PD-1 | hPD-1 | CD279 | PDCD1 | PD1

Gen-ID: 18566

UniProt: Q02242

Pathways: Cancer Immune Checkpoints