IKZF1 Antikörper

Produktnummer ABIN4951433

Produktdetails anti-IKZF1 Antikörper

Target: IKZF1 (IKAROS Family Zinc Finger 1 (Ikaros) (IKZF1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IKZF1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Aufreinigung: Antigen affinity

Immunogen: Amino acids LKEEHRAYDLLRAASENSQDALRVVSTSGEQM of human IKZF1 were used as the immunogen for the IKAROS antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the IKAROS antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the IKAROS antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu IKZF1

Target: IKZF1 (IKAROS Family Zinc Finger 1 (Ikaros) (IKZF1))

Andere Bezeichnung: IKAROS / IKZF1 (IKZF1 Produkte)

Synonyme: Hs.54452 antikoerper, IK1 antikoerper, IKAROS antikoerper, LYF1 antikoerper, PRO0758 antikoerper, ZNFN1A1 antikoerper, hIk-1 antikoerper, RGD1562979 antikoerper, ikaros antikoerper, znfn1a1 antikoerper, ik1 antikoerper, lyf1 antikoerper, hik-1 antikoerper, pro0758 antikoerper, hs.54452 antikoerper, MGC108252 antikoerper, 5832432G11Rik antikoerper, Ikaros antikoerper, LyF-1 antikoerper, Zfpn1a1 antikoerper, Znfn1a1 antikoerper, hlk-1 antikoerper, mKIAA4227 antikoerper, ikzf1 antikoerper, IKAROS family zinc finger 1 antikoerper, IKAROS family zinc finger 1 (Ikaros) antikoerper, IKZF1 antikoerper, Ikzf1 antikoerper, ikzf1 antikoerper

Hintergrund: DNA-binding protein Ikaros is a protein that in humans is encoded by the IKZF1 gene. This gene encodes a transcription factor that belongs to the family of zinc-finger DNA-binding proteins associated with chromatin remodeling. The expression of this protein is restricted to the fetal and adult hemo-lymphopoietic system, and it functions as a regulator of lymphocyte differentiation. Several alternatively spliced transcript variants encoding different isoforms have been described for this gene. Most isoforms share a common C-terminal domain, which contains two zinc finger motifs that are required for hetero- or homo-dimerization, and for interactions with other proteins. The isoforms, however, differ in the number of N-terminal zinc finger motifs that bind DNA and in nuclear localization signal presence, resulting in members with and without DNA-binding properties. Only a few isoforms contain the requisite three or more N-terminal zinc motifs that confer high affinity binding to a specific core DNA sequence element in the promoters of target genes. The non-DNA-binding isoforms are largely found in the cytoplasm, and are thought to function as dominant-negative factors.

UniProt: Q13422

Pathways: Production of Molecular Mediator of Immune Response