Insulin Receptor Antikörper (N-Term)
-
- Target Alle Insulin Receptor (INSR) Antikörper anzeigen
- Insulin Receptor (INSR)
-
Bindungsspezifität
- AA 38-76, N-Term
-
Reaktivität
- Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Insulin Receptor Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Insulin receptor(INSR) detection. Tested with WB in Human,Rat.
- Sequenz
- MDIRNNLTRL HELENCSVIE GHLQILLMFK TRPEDFRDL
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Insulin receptor(INSR) detection. Tested with WB in Human,Rat.
Gene Name: insulin receptor
Protein Name: Insulin receptor - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human Insulin Receptor (38-76aa MDIRNNLTRLHELENCSVIEGHLQILLMFKTRPEDFRDL), identical to the related mouse and rat sequences.
- Isotyp
- IgG
- Top Product
- Discover our top product INSR Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
-
Resveratrol attenuates intermittent hypoxia-induced insulin resistance in rats: involvement of Sirtuin 1 and the phosphatidylinositol-4,5-bisphosphate 3-kinase/AKT pathway." in: Molecular medicine reports, Vol. 11, Issue 1, pp. 151-8, (2014) (PubMed).
: "
-
Resveratrol attenuates intermittent hypoxia-induced insulin resistance in rats: involvement of Sirtuin 1 and the phosphatidylinositol-4,5-bisphosphate 3-kinase/AKT pathway." in: Molecular medicine reports, Vol. 11, Issue 1, pp. 151-8, (2014) (PubMed).
-
- Target
- Insulin Receptor (INSR)
- Andere Bezeichnung
- INSR (INSR Produkte)
- Synonyme
- CD220 antikoerper, HHF5 antikoerper, 4932439J01Rik antikoerper, D630014A15Rik antikoerper, IR antikoerper, IR-A antikoerper, IR-B antikoerper, 18402 antikoerper, CG18402 antikoerper, DIHR antikoerper, DILR antikoerper, DIR antikoerper, DIRH antikoerper, DIRbeta antikoerper, DInR antikoerper, DInr antikoerper, Dir-a antikoerper, Dir-b antikoerper, Dmel\\CG18402 antikoerper, INR antikoerper, INS antikoerper, Inr antikoerper, Inr-alpha antikoerper, Inr-beta antikoerper, InsR antikoerper, dINR antikoerper, dIR antikoerper, dIRH antikoerper, dInR antikoerper, dInr antikoerper, dInsR antikoerper, dinr antikoerper, dir antikoerper, er10 antikoerper, inr antikoerper, insulin/insulin-like growth factor receptor antikoerper, l(3)05545 antikoerper, l(3)93Dj antikoerper, l(3)er10 antikoerper, lnR antikoerper, ir-A antikoerper, CTK-1 antikoerper, ir antikoerper, INSR antikoerper, NV14476 antikoerper, cd220 antikoerper, hhf5 antikoerper, insulin receptor antikoerper, Insulin-like receptor antikoerper, insulin receptor L homeolog antikoerper, INSR antikoerper, Insr antikoerper, InR antikoerper, LOC100122567 antikoerper, LOC100451802 antikoerper, insr.L antikoerper
- Hintergrund
-
INSR(INSULIN RECEPTOR) is a tetramer of 2 alpha and 2 beta subunits that are coded by a single gene and are joined by disulfide bonds, a mechanism parallel to that of its ligand, insulin. It belongs to the large class of tyrosine kinase receptors. The insulin receptor gene is mapped to 19p13.2. The insulin receptor mediates their activity by causing the addition of a phosphate group to particular tyrosines on certain proteins within a cell. The INSR gene spans more than 120 kb and has 22 exons. Functional studies of the INSR SNPs show no effect on mRNA levels or splicing in peripheral blood leukocytes or on binding of insulin to mononuclear cells.
Synonyms: CD 220 | CD220 | HHF5 | HIR A | insulin receptor | INSR alpha | insulin receptor a | Insulin Receptor alpha | Insulin receptor subunit alpha | Insulin receptor subunit beta | Insulin receptor(IR) | InsulinReceptor | Insulinreceptor(IR) | IR 1 | P06213 - Gen-ID
- 3643
- UniProt
- P06213
- Pathways
- NF-kappaB Signalweg, RTK Signalweg, AMPK Signaling, Carbohydrate Homeostasis, Regulation of Cell Size, Regulation of Carbohydrate Metabolic Process, Growth Factor Binding, Negative Regulation of Transporter Activity
-