TLR10 Antikörper (AA 81-111)
-
- Target Alle TLR10 Antikörper anzeigen
- TLR10 (Toll-Like Receptor 10 (TLR10))
-
Bindungsspezifität
- AA 81-111
-
Reaktivität
- Human
-
Wirt
- Ziege
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TLR10 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC), Immunocytochemistry (ICC)
- Spezifität
- Peptide sequence is <50 % identical to other human TLR receptors in this region. The antibody recognizes human TLR10.
- Homologie
- Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon (100%) Orangutan, Monkey (97%) Marmoset (94%) Sheep, Goat, Zebu, Bovine (87%) Elephant, Horse (84%) Panda, Pig (81%).
- Aufreinigung
- Immunoaffinity purified
- Immunogen
-
31 amino acid (aa) synthetic peptide C-HNRIQQLDLKTFEFNKELRYLDLSNNRLKSV corresponding to aa 81-111 of the N-terminal domain of Human TLR10. Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon (100%), Orangutan, Monkey (97%), Marmoset (94%), Sheep, Goat, Zebu, Bovine (87%), Elephant, Horse (84%), Panda, Pig (81%).
Type of Immunogen: Synthetic peptide - Top Product
- Discover our top product TLR10 Primärantikörper
-
anti-Toll-Like Receptor 10 (TLR10) (AA 1-811) antibody
TLR10 Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 2A11 unconjugated
anti-Toll-Like Receptor 10 (TLR10) (AA 20-250) antibodyTLR10 Reaktivität: Ratte WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Toll-Like Receptor 10 (TLR10) (AA 617-784) antibodyTLR10 Reaktivität: Human WB, IHC, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Toll-Like Receptor 10 (TLR10) (AA 20-474) antibody (PE)TLR10 Reaktivität: Human ICFC Wirt: Maus Monoclonal 3C10C5 PE
-
- Applikationshinweise
- Approved: ICC (1:200), IHC, WB
- Kommentare
-
Target Species of Antibody: Human
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Liquid
- Konzentration
- Lot specific
- Buffer
- Phosphate buffered saline, 1 mg/mL BSA, 0.1 % sodium azide
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Aliquot to Avoid freeze/thaw cycles.
- Lagerung
- -20 °C
- Informationen zur Lagerung
- Store at -20°C. Aliquot to avoid freeze/thaw cycles.
-
- Target
- TLR10 (Toll-Like Receptor 10 (TLR10))
- Andere Bezeichnung
- TLR10 (TLR10 Produkte)
- Synonyme
- TLR10 antikoerper, CD290 antikoerper, toll like receptor 10 antikoerper, toll-like receptor 10 antikoerper, TLR10 antikoerper, Tlr10 antikoerper
- Hintergrund
-
Name/Gene ID: TLR10
Family: Toll-like Receptor
Synonyms: TLR10, CD290, CD290 antigen, Toll-like receptor 10 - Gen-ID
- 81793
- UniProt
- Q9BXR5
- Pathways
- TLR Signalweg, Activation of Innate immune Response, Toll-Like Receptors Cascades
-
