TLR10 Antikörper (AA 81-111)

Produktnummer ABIN342786

Dieses Anti-TLR10-Antikörper ist ein Ziege Polyklonal-Antikörper zur Detektion von TLR10 in WB, IHC und ICC. Geeignet für Human.

Kurzübersicht für TLR10 Antikörper (AA 81-111) (ABIN342786)

Target: TLR10 (Toll-Like Receptor 10 (TLR10))

Reaktivität: Human

Wirt: Ziege

Klonalität: Polyklonal

Konjugat: Dieser TLR10 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC), Immunocytochemistry (ICC)

Produktdetails anti-TLR10 Antikörper

Bindungsspezifität: AA 81-111

Spezifität: Peptide sequence is <50 % identical to other human TLR receptors in this region. The antibody recognizes human TLR10.

Homologie: Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon (100%) Orangutan, Monkey (97%) Marmoset (94%) Sheep, Goat, Zebu, Bovine (87%) Elephant, Horse (84%) Panda, Pig (81%).

Aufreinigung: Immunoaffinity purified

Immunogen: 31 amino acid (aa) synthetic peptide C-HNRIQQLDLKTFEFNKELRYLDLSNNRLKSV corresponding to aa 81-111 of the N-terminal domain of Human TLR10. Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon (100%), Orangutan, Monkey (97%), Marmoset (94%), Sheep, Goat, Zebu, Bovine (87%), Elephant, Horse (84%), Panda, Pig (81%).

Type of Immunogen: Synthetic peptide

Anwendungsinformationen

Applikationshinweise: Approved: ICC (1:200), IHC, WB

Kommentare:

Target Species of Antibody: Human

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Liquid

Konzentration: Lot specific

Buffer: Phosphate buffered saline, 1 mg/mL BSA, 0.1 % sodium azide

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Aliquot to Avoid freeze/thaw cycles.

Lagerung: -20 °C

Informationen zur Lagerung: Store at -20°C. Aliquot to avoid freeze/thaw cycles.

Details zu TLR10

Target: TLR10 (Toll-Like Receptor 10 (TLR10))

Andere Bezeichnung: TLR10

Hintergrund: Name/Gene ID: TLR10
Family: Toll-like Receptor

Synonyms: TLR10, CD290, CD290 antigen, Toll-like receptor 10

Gen-ID: 81793

UniProt: Q9BXR5

Pathways: TLR Signalweg, Activation of Innate immune Response, Toll-Like Receptors Cascades