TLR8 Antikörper (AA 81-109)
-
- Target Alle TLR8 Antikörper anzeigen
- TLR8 (Toll-Like Receptor 8 (TLR8))
-
Bindungsspezifität
- AA 81-109
-
Reaktivität
- Human
-
Wirt
- Ziege
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TLR8 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunocytochemistry (ICC)
- Spezifität
- Peptide sequence is <50 % identical to other human TLR receptors in this region. The antibody recognizes human TLR8 and mouse TLR8.
- Homologie
- Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon (100%) Monkey (93%) Marmoset (86%).
- Aufreinigung
- Immunoaffinity purified
- Immunogen
-
30 amino acid (aa)synthetic peptide C-ESFQGLQNLTKINLNHNPNVQHQNGNPGI corresponding to aa 81-109 of the N-terminal domain of Human TLR8. Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon (100%), Monkey (93%), Marmoset (86%).
Type of Immunogen: Synthetic peptide - Top Product
- Discover our top product TLR8 Primärantikörper
-
-
- Applikationshinweise
- Approved: ICC (1:200), WB
- Kommentare
-
Target Species of Antibody: Human
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Liquid
- Konzentration
- Lot specific
- Buffer
- Phosphate buffered saline, 1 mg/mL BSA, 0.1 % sodium azide
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Aliquot to Avoid freeze/thaw cycles.
- Lagerung
- -20 °C
- Informationen zur Lagerung
- Store at -20°C. Aliquot to avoid freeze/thaw cycles.
-
- Target
- TLR8 (Toll-Like Receptor 8 (TLR8))
- Andere Bezeichnung
- TLR8 (TLR8 Produkte)
- Synonyme
- CD288 antikoerper, toll like receptor 8 antikoerper, toll-like receptor 8 antikoerper, TLR8 antikoerper, Tlr8 antikoerper
- Hintergrund
-
Name/Gene ID: TLR8
Family: Toll-like Receptor
Synonyms: TLR8, CD288, Toll-like receptor 8, CD288 antigen - Gen-ID
- 51311
- UniProt
- Q9NR97
- Pathways
- TLR Signalweg, Activation of Innate immune Response, Toll-Like Receptors Cascades
-