CHEK2 Antikörper (C-Term)

Produktnummer ABIN3043811

Produktdetails anti-CHEK2 Antikörper

Target: CHEK2 (Checkpoint Kinase 2 (CHEK2))

Bindungsspezifität: AA 465-498, C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CHEK2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Serine/threonine-protein kinase Chk2(CHEK2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequenz: KLLVVDPKAR FTTEEALRHP WLQDEDMKRK FQDL

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Serine/threonine-protein kinase Chk2(CHEK2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: checkpoint kinase 2
Protein Name: Serine/threonine-protein kinase Chk2

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Chk2 (465-498aa KLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDL), different from the related mouse sequence by four amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu CHEK2

Target: CHEK2 (Checkpoint Kinase 2 (CHEK2))

Andere Bezeichnung: CHEK2 (CHEK2 Produkte)

Synonyme: CDS1 antikoerper, CHK2 antikoerper, HuCds1 antikoerper, LFS2 antikoerper, PP1425 antikoerper, RAD53 antikoerper, hCds1 antikoerper, fa66f08 antikoerper, wu:fa66f08 antikoerper, zgc:55865 antikoerper, Cds1 antikoerper, HUCDS1 antikoerper, Rad53 antikoerper, Chk2 antikoerper, cds1 antikoerper, chek2 antikoerper, chk2 antikoerper, hucds1 antikoerper, lfs2 antikoerper, pp1425 antikoerper, rad53 antikoerper, checkpoint kinase 2 antikoerper, serine/threonine-protein kinase chk2 antikoerper, checkpoint kinase 2 L homeolog antikoerper, CHEK2 antikoerper, chek2 antikoerper, Chek2 antikoerper, MCYG_07308 antikoerper, chek2.L antikoerper

Hintergrund: CHK2, a protein kinase that is activated in response to DNA damage, is involved in cell cycle arrest. Mapped on 22q12.1, CHK2 has a potential regulatory region rich in SQ and TQ amino acid pairs. It regulates BRCA1 function after DNA damage by phosphorylating serine-988 of BRCA1. Additionally, CHK2 can be modified by phosphorylation and activated in response to ionizing radiation, and can be also modified in response to hydroxyurea treatment. Furthermore, oligomerization of CHEK2 increases the efficiency of transautophosphorylation, resulting in the release of active CHEK2 monomers that proceed to enforce checkpoint control in irradiated cells. Moreover, CHK2 is a tumor suppressor gene conferring predisposition to sarcoma, breast cancer, and brain tumors, and that their observations provided a link between the central role of p53 inactivation in human cancer and the well-defined G2 checkpoint in yeast. There is a wide expression of small amounts of CHK2 mRNA with larger amounts in human testis, spleen, colon, and peripheral blood leukocytes.

Synonyms: bA444G7 antibody|CDS 1 antibody|CDS1 antibody|Checkpoint kinase 2 antibody|Checkpoint like protein CHK2 antibody|Chek 2 antibody|Chek2 antibody|Chk 2 antibody|CHK2 checkpoint homolog (S. pombe) antibody|CHK2 checkpoint homolog antibody|CHK2_HUMAN antibody|HuCds 1 antibody| HuCds1 antibody|LFS 2 antibody|LFS2 antibody|PP1425 antibody|RAD 53 antibody|RAD53 antibody|Rad53 homolog antibody|Serine/threonine protein kinase Chk2 antibody| Serine/ threonine-protein kinase Chk2 antibody

Gen-ID: 11200

UniProt: O96017

Pathways: p53 Signalweg, Apoptose, Zellzyklus