BMI1 Antikörper (Middle Region)

Produktnummer ABIN3043799

Produktdetails anti-BMI1 Antikörper

Target: BMI1 (BMI1 Polycomb Ring Finger Oncogene (BMI1))

Bindungsspezifität: AA 135-165, Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser BMI1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Polycomb complex protein BMI-1(BMI1) detection. Tested with WB in Human,Mouse,Rat.

Sequenz: IEFFDQNRLD RKVNKDKEKS KEEVNDKRYL R

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Polycomb complex protein BMI-1(BMI1) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: BMI1 proto-oncogene, polycomb ring finger
Protein Name: Polycomb complex protein BMI-1

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Bmi1(135-165aa IEFFDQNRLDRKVNKDKEKSKEEVNDKRYLR), different from the related mouse sequence by four amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat, The detection limit for Bmi1 is approximately 0.25 ng/lane under reducing conditions.
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu BMI1

Target: BMI1 (BMI1 Polycomb Ring Finger Oncogene (BMI1))

Andere Bezeichnung: BMI1 (BMI1 Produkte)

Synonyme: FLVI2/BMI1 antikoerper, PCGF4 antikoerper, RNF51 antikoerper, AW546694 antikoerper, Bmi-1 antikoerper, Pcgf4 antikoerper, bmi1 antikoerper, pcgf4 antikoerper, psc1 antikoerper, wu:fb17g03 antikoerper, wu:fd18f06 antikoerper, BMI-1 antikoerper, pcgf4b antikoerper, bmi-1 antikoerper, bmi1-a antikoerper, bmi1-b antikoerper, bmi1b antikoerper, rnf51 antikoerper, xbmi-1 antikoerper, BMI1 proto-oncogene, polycomb ring finger antikoerper, BMI1 polycomb ring finger oncogene antikoerper, Bmi1 polycomb ring finger oncogene antikoerper, bmi1 polycomb ring finger oncogene 1a antikoerper, bmi1 polycomb ring finger oncogene 1b antikoerper, BMI1 proto-oncogene, polycomb ring finger L homeolog antikoerper, BMI1 antikoerper, LOC100230513 antikoerper, Bmi1 antikoerper, bmi1a antikoerper, bmi1b antikoerper, bmi1.L antikoerper

Hintergrund: BMI1(BMI1 polycomb ring finger oncogene), also known as RNF51, is a protein which in humans is encoded by the BMI1 gene. The Bmi1 gene is highly conserved in evolution as indicated by zoo blot hybridization with Bmi1 probes corresponding to the protein-encoding domain. By fluorescence in situ hybridization, the human BMI1 gene is assigned to chromosome 10p13. BMI1 has a key role in regulating the proliferative activity of normal stem and progenitor cells. Most importantly, they provided evidence that the proliferative potential of leukemic stem and progenitor cells lacking BMI1 is compromised because they eventually undergo proliferation arrest and show signs of differentiation and apoptosis, leading to transplant failure of the leukemia. Complementation studies showed that BMI1 completely rescues these proliferative defects. Deletion analysis showed that the RING finger and helix-turn-helix domains of BMI1 were required for life span extension and repression of the tumor suppressor p16(INK4). BMI1 selectively extended the life span of these cultures. Confocal microscopy showed that BMI1 transiently colocalized with centromeres during interphase in HeLa cells.

Synonyms: B lymphoma Mo MLV insertion region (mouse) antibody|B lymphoma Mo MLV insertion region 1 homolog antibody|Bmi 1 antibody|BMI1 antibody|BMI1 polycomb ring finger oncogene antibody|BMI1_HUMAN antibody|Flvi 2/bmi 1 antibody|FLVI2/BMI1 antibody|MGC12685 antibody|Murine leukemia viral (bmi 1) oncogene homolog antibody|Oncogene BMI 1 antibody|PCGF 4 antibody|PCGF4 antibody|Polycomb complex protein BMI 1 antibody|Polycomb complex protein BMI-1 antibody|Polycomb group protein Bmi1 antibody|Polycomb group ring finger 4 antibody|Polycomb group RING finger protein 4 antibody|RING finger protein 51 antibody|RNF 51 antibody|RNF51 antibody

Gen-ID: 648

UniProt: P35226

Pathways: Zellzyklus, Autophagie