ATG14 Antikörper (N-Term)

Produktnummer ABIN3043721

Produktdetails anti-ATG14 Antikörper

Target: ATG14 (ATG14 Autophagy Related 14 (ATG14))

Bindungsspezifität: AA 70-101, N-Term

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ATG14 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Beclin 1-associated autophagy-related key regulator (ATG14) detection. Tested with WB, IHC-P in Human,Rat.

Sequenz: RDRERFIDKK ERLSRLKSKQ EEFQKEVLKA ME

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Beclin 1-associated autophagy-related key regulator (ATG14) detection. Tested with WB, IHC-P in Human,Rat.
Gene Name: autophagy related 14
Protein Name: Beclin 1-associated autophagy-related key regulator

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human ATG14L (70-101aa RDRERFIDKKERLSRLKSKQEEFQKEVLKAME), different from the related mouse and rat sequences by two amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu ATG14

Target: ATG14 (ATG14 Autophagy Related 14 (ATG14))

Andere Bezeichnung: ATG14 (ATG14 Produkte)

Synonyme: ATG14L antikoerper, BARKOR antikoerper, KIAA0831 antikoerper, 4832427M01 antikoerper, Atg14L antikoerper, D14Ertd114e antikoerper, D14Ertd436e antikoerper, RGD1304610 antikoerper, autophagy related 14 antikoerper, ATG14 antikoerper, Atg14 antikoerper

Hintergrund: ATG14 (also known as beclin-1-associated autophagy-related key regulator (Barkor) or ATG14L), an essential autophagy-specific regulator of the class III phosphatidylinositol 3-kinase complex, promotes membrane tethering of protein-free liposomes, and enhances hemifusion and full fusion of proteoliposomes reconstituted with the target (t)-SNAREs (soluble N-ethylmaleimide-sensitive factor attachment protein receptors) syntaxin 17 (STX17) and SNAP29, and the vesicle (v)-SNARE VAMP8 (vesicle-associated membrane protein 8). ATG14 binds to the SNARE core domain of STX17 through its coiled-coil domain, and stabilizes the STX17-SNAP29 binary t-SNARE complex on autophagosomes.

Synonyms: 4832427M01 antibody|ATG14 antibody|Atg14L antibody|Autophagy-related protein 14-like protein antibody|BAKOR_HUMAN antibody|Barkor antibody|Beclin 1-associated autophagy-related key regulator antibody|D14Ertd114e antibody|D14Ertd436e antibody|KIAA0831 antibody|mCG_6911 antibody

Gen-ID: 22863

Pathways: Autophagie