LOXL2 Antikörper (C-Term)

Produktnummer ABIN3043464

Produktdetails anti-LOXL2 Antikörper

Target: LOXL2 (Lysyl Oxidase-Like 2 (LOXL2))

Bindungsspezifität: AA 739-770, C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LOXL2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Lysyl oxidase homolog 2(LOXL2) detection. Tested with WB in Human,Mouse,Rat.

Sequenz: HRIWMYNCHI GGSFSEETEK KFEHFSGLLN NQ

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Lysyl oxidase homolog 2(LOXL2) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: lysyl oxidase-like 2
Protein Name: Lysyl oxidase homolog 2

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human LOXL2 (739-770aa HRIWMYNCHIGGSFSEETEKKFEHFSGLLNNQ), different from the related mouse and rat sequences by four amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu LOXL2

Target: LOXL2 (Lysyl Oxidase-Like 2 (LOXL2))

Andere Bezeichnung: LOXL2 (LOXL2 Produkte)

Synonyme: LOR2 antikoerper, WS9-14 antikoerper, CG4402 antikoerper, Dmel\\CG4402 antikoerper, Dmloxl-2 antikoerper, dmlox-2 antikoerper, 1110004B06Rik antikoerper, 4930526G11Rik antikoerper, 9430067E15Rik antikoerper, GB13360 antikoerper, lox2-like antikoerper, LOXL2 antikoerper, lor2 antikoerper, loxl-2 antikoerper, ws9-14 antikoerper, im:7136137 antikoerper, si:dkeyp-32b1.1 antikoerper, wu:fk12g04 antikoerper, zgc:158414 antikoerper, lysyl oxidase like 2 antikoerper, lysyl oxidase-like 2 antikoerper, lysyl oxidase homolog 4 antikoerper, lysyl oxidase like 2 L homeolog antikoerper, lysyl oxidase-like 2b antikoerper, LOXL2 antikoerper, lox2 antikoerper, Loxl2 antikoerper, LOC408544 antikoerper, loxl2.L antikoerper, loxl2 antikoerper, loxl2b antikoerper

Hintergrund: Lysyl oxidase homolog 2 is an enzyme that in humans is encoded by the LOXL2 gene. This gene encodes a member of the lysyl oxidase gene family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function. The N-terminus is poorly conserved and may impart additional roles in developmental regulation, senescence, tumor suppression, cell growth control, and chemotaxis to each member of the family. LOXL2 can also crosslink collagen type IV and hence influence the sprouting of new blood vessels.

Synonyms: LOR 2 antibody|LOR2 antibody|LOX L2 antibody|LOXL 2 antibody|LOXL2 antibody|LOXL2_HUMAN antibody|Lysyl oxidase homolog 2 antibody| Lysyl oxidase like 2 antibody|Lysyl oxidase like protein 2 antibody|Lysyl oxidase related 2 antibody|Lysyl oxidase related protein 2 antibody|Lysyl oxidase related protein WS9 14 antibody|Lysyl oxidase-like protein 2 antibody|Lysyl oxidase-related protein 2 antibody| Lysyl oxidase-related protein WS9-14 antibody|WS9 14 antibody

Gen-ID: 4017

UniProt: Q9Y4K0

Pathways: Chromatin Binding