MLH1 Antikörper (C-Term)

Produktnummer ABIN3043404

Produktdetails anti-MLH1 Antikörper

Target: MLH1 (MutL Homolog 1 (MLH1))

Bindungsspezifität: AA 722-756, C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MLH1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for DNA mismatch repair protein Mlh1(MLH1) detection. Tested with WB in Human,Mouse,Rat.

Sequenz: KALRSHILPP KHFTEDGNIL QLANLPDLYK VFERC

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for DNA mismatch repair protein Mlh1(MLH1) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: mutL homolog 1
Protein Name: DNA mismatch repair protein Mlh1

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human MLH1 (722-756aa KALRSHILPPKHFTEDGNILQLANLPDLYKVFERC), different from the related mouse sequence by three amino acids, and from the related rat sequence by four amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu MLH1

Target: MLH1 (MutL Homolog 1 (MLH1))

Andere Bezeichnung: MLH1 (MLH1 Produkte)

Synonyme: CG11482 antikoerper, Dmel\\CG11482 antikoerper, dmlh-1 antikoerper, dmlh1 antikoerper, zgc:66301 antikoerper, MLH1 antikoerper, LOC100232198 antikoerper, 1110035C23Rik antikoerper, AI317206 antikoerper, AI325952 antikoerper, AI561766 antikoerper, COCA2 antikoerper, FCC2 antikoerper, HNPCC antikoerper, HNPCC2 antikoerper, hMLH1 antikoerper, mutL homolog 1 antikoerper, CG11482 gene product from transcript CG11482-RB antikoerper, mutL homolog 1 S homeolog antikoerper, mutL homolog 1, colon cancer, nonpolyposis type 2 (E. coli) antikoerper, DNA mismatch repair protein Mlh1 antikoerper, MLH1 antikoerper, Mlh1 antikoerper, mlh1.S antikoerper, mlh1 antikoerper, LOC588545 antikoerper

Hintergrund: MutL homolog 1, colon cancer, nonpolyposis type 2 (E. coli) is a protein that in humans is encoded by the MLH1 gene located on Chromosome 3. This gene was identified as a locus frequently mutated in hereditary nonpolyposis colon cancer (HNPCC). It is a human homolog of the E. coli DNA mismatch repair gene mutL, consistent with the characteristic alterations in microsatellite sequences (RER+phenotype) found in HNPCC. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Additional transcript variants have been described, but their full-length natures have not been determined.

Synonyms: COCA 2 antibody|COCA2 antibody|DNA mismatch repair protein Mlh1 antibody|FCC 2 antibody|FCC2 antibody|hMLH 1 antibody|hMLH1 antibody| HNPCC 2 antibody|HNPCC antibody|HNPCC2 antibody|MGC5172 antibody|MLH 1 antibody|MLH1 antibody|MLH1_HUMAN antibody|MutL homolog 1 (E. coli) antibody|MutL homolog 1 antibody|MutL homolog 1 colon cancer nonpolyposis type 2 antibody|MutL homolog 1, colon cancer, nonpolyposis type 2 (E. coli) antibody|MutL protein homolog 1 antibody|MutL, E. coli, homolog of, 1 antibody

Gen-ID: 4292

UniProt: P40692

Pathways: DNA Reparatur, Production of Molecular Mediator of Immune Response