Stathmin 1 Antikörper (N-Term)

Produktnummer ABIN3043301

Produktdetails anti-Stathmin 1 Antikörper

Target: Stathmin 1 (STMN1)

Bindungsspezifität: AA 2-34, N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Stathmin 1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Stathmin(STMN1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequenz: ASSDIQVKEL EKRASGQAFE LILSPRSKES VPE

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Stathmin(STMN1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: stathmin 1
Protein Name: Stathmin

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Stathmin 1 (2-34aa ASSDIQVKELEKRASGQAFELILSPRSKESVPE), different from the related mouse sequence by one amino acid, and identical to the related rat sequence.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu Stathmin 1

Target: Stathmin 1 (STMN1)

Andere Bezeichnung: STMN1 (STMN1 Produkte)

Synonyme: C1orf215 antikoerper, LAP18 antikoerper, Lag antikoerper, OP18 antikoerper, PP17 antikoerper, PP19 antikoerper, PR22 antikoerper, SMN antikoerper, 19k antikoerper, Lap18 antikoerper, Op18 antikoerper, P18 antikoerper, P19 antikoerper, Pig antikoerper, Pp17 antikoerper, Pp18 antikoerper, Pp19 antikoerper, Pr22 antikoerper, Smn antikoerper, prosolin antikoerper, op18 antikoerper, stathmin antikoerper, stmn1 antikoerper, stmn1a antikoerper, lag antikoerper, lap18 antikoerper, pp17 antikoerper, pp19 antikoerper, pr22 antikoerper, smn antikoerper, fj43c10 antikoerper, wu:fj38b07 antikoerper, wu:fj43c10 antikoerper, zgc:110159 antikoerper, cb959 antikoerper, wu:fb14e04 antikoerper, zgc:136942 antikoerper, stmn1-a antikoerper, stmn1b antikoerper, xo35 antikoerper, stathmin 1 antikoerper, stathmin 1 S homeolog antikoerper, stathmin 1b antikoerper, stathmin 1a antikoerper, stathmin-like antikoerper, stathmin antikoerper, stathmin 1 L homeolog antikoerper, STMN1 antikoerper, Stmn1 antikoerper, stmn1.S antikoerper, stmn1 antikoerper, stmn1b antikoerper, stmn1a antikoerper, LOC100229194 antikoerper, stmn1.L antikoerper

Hintergrund: Stathmin 1/oncoprotein 18, also known as STMN1, is a highly conserved 17 kDa protein. This gene belongs to the stathmin family of genes. It encodes a ubiquitous cytosolic phosphoprotein proposed to function as an intracellular relay integrating regulatory signals of the cellular environment. The encoded protein is involved in the regulation of the microtubule filament system by destabilizing microtubules. It prevents assembly and promotes disassembly of microtubules. Multiple transcript variants encoding different isoforms have been found for this gene.

Synonyms: C1orf215 antibody|Lag antibody|LAP 18 antibody|LAP18 antibody|Leukemia associated phosphoprotein p18 antibody|Leukemia-associated phosphoprotein p18 antibody|Metablastin antibody|Oncoprotein 18 antibody|OP 18 antibody|OP18 antibody|p18 antibody|p19 antibody| Phosphoprotein 19 antibody|Phosphoprotein p19 antibody|PP17 antibody|PP19 antibody|PR22 antibody|Pr22 protein antibody|Prosolin antibody|Protein Pr22 antibody|SMN antibody| Stathmin antibody|Stathmin1 antibody|STMN 1 antibody|STMN1 antibody|STMN1_HUMAN antibody

Gen-ID: 3925

UniProt: P16949

Pathways: MAPK Signalweg, Microtubule Dynamics