HTR2A Antikörper (C-Term)
-
- Target Alle HTR2A Antikörper anzeigen
- HTR2A (5-Hydroxytryptamine (serotonin) Receptor 2A (HTR2A))
-
Bindungsspezifität
- AA 400-431, C-Term
-
Reaktivität
- Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser HTR2A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Verwendungszweck
- Rabbit IgG polyclonal antibody for 5-hydroxytryptamine receptor 2A(HTR2A) detection. Tested with WB in Human,Rat.
- Sequenz
- KENKKPLQLI LVNTIPALAY KSSQLQMGQK KN
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for 5-hydroxytryptamine receptor 2A(HTR2A) detection. Tested with WB in Human,Rat.
Gene Name: 5-hydroxytryptamine (serotonin) receptor 2A, G protein-coupled
Protein Name: 5-hydroxytryptamine receptor 2A - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human 5HT2A Receptor (400-431aa KENKKPLQLILVNTIPALAYKSSQLQMGQKKN) , different from the related mouse sequence by three amino acids, and from the related rat sequence by two amino acids.
- Isotyp
- IgG
- Top Product
- Discover our top product HTR2A Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- HTR2A (5-Hydroxytryptamine (serotonin) Receptor 2A (HTR2A))
- Andere Bezeichnung
- HTR2A (HTR2A Produkte)
- Synonyme
- 5-HT2A antikoerper, HTR2 antikoerper, 5-HT-2 antikoerper, 5-HT-2A antikoerper, 5-HTR2A antikoerper, LOC100009461 antikoerper, E030013E04 antikoerper, Htr-2 antikoerper, Htr2 antikoerper, 5Ht-2 antikoerper, 5HT2A antikoerper, 5HTR2A antikoerper, HTR2A antikoerper, Htr2a antikoerper, 5HT2 antikoerper, 5-hydroxytryptamine receptor 2A antikoerper, 5-hydroxytryptamine (serotonin) receptor 2A antikoerper, HTR2A antikoerper, Htr2a antikoerper
- Hintergrund
-
The mammalian HTR2A (5-HT2A receptor) is a subtype of the 5-HT2 receptor that belongs to the serotonin receptor family and is a G protein-coupled receptor (GPCR). This is the main excitatory receptor subtype among the GPCRs for serotonin (5-HT), although 5-HT2A may also have an inhibitory effect on certain areas such as the visual cortex and the orbit frontal cortex. This receptor was given importance first as the target of psychedelic drugs like LSD. Later it came back to prominence because it was also found to be mediating, at least partly, the action of many antipsychotic drugs, especially the atypical ones. 5-HT2A also happens to be a necessary receptor for the spread of the human polyoma virus called JC virus. Sparkes et al. (1991) concluded that the gene is located on 13q14-q21 in man and on chromosome 14 in the mouse.
Synonyms: 5 HT 2 antibody|5 HT 2A antibody|5 HT2 receptor antibody|5 HT2A antibody|5 hydroxytryptamine receptor 2A antibody|5-HT-2 antibody|5-HT-2A antibody|5-hydroxytryptamine (serotonin) receptor 2A, G protein-coupled antibody|5-hydroxytryptamine 2A receptor antibody|5-hydroxytryptamine receptor 2A antibody|5HT2A_HUMAN antibody|HTR 2 antibody|HTR 2A antibody|HTR2 antibody|HTR2, formerly antibody|HTR2A antibody|serotonin 5-HT-2 receptor, formerly antibody|serotonin 5-HT-2A receptor antibody|Serotonin receptor 2A antibody - Gen-ID
- 3356
- UniProt
- P28223
- Pathways
- JAK-STAT Signalweg, Inositol Metabolic Process, Regulation of Carbohydrate Metabolic Process
-