GJA3 Antikörper (N-Term)
-
- Target Alle GJA3 Antikörper anzeigen
- GJA3 (Gap Junction Protein, alpha 3, 46kDa (GJA3))
-
Bindungsspezifität
- AA 89-118, N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GJA3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Gap junction alpha-3 protein(GJA3) detection. Tested with WB in Human,Mouse,Rat.
- Sequenz
- TLIYLGHVLH IVRMEEKKKE REEEEQLKRE
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Gap junction alpha-3 protein(GJA3) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: gap junction protein, alpha 3, 46 kDa
Protein Name: Gap junction alpha-3 protein - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human GJA3 (89-118aa TLIYLGHVLHIVRMEEKKKEREEEEQLKRE), different from the related mouse and rat sequences by four amino acids.
- Isotyp
- IgG
- Top Product
- Discover our top product GJA3 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- GJA3 (Gap Junction Protein, alpha 3, 46kDa (GJA3))
- Andere Bezeichnung
- GJA3 (GJA3 Produkte)
- Hintergrund
-
Gap junction alpha-3 protein, also known as Connexin-46, is a protein that in humans is encoded by the GJA3 gene. This gene is mapped to 13q12.11. The protein encoded by this gene is a connexin and is a component of lens fiber gap junctions. One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell. Defects in this gene are a cause of zonular pulverulent cataract type 3 (CZP3).
Synonyms: CAE3 antibody|Connexin 46 antibody|Connexin-46 antibody|Connexin46 antibody|Cx46 antibody|CXA3_HUMAN antibody|CZP3 antibody|Gap junction alpha 3 protein antibody|Gap junction alpha-3 protein antibody|Gap junction protein, alpha 3, 46kD (connexin 46) antibody|Gap junction protein, alpha 3, 46 kDa (connexin 46) antibody|Gap junction protein, alpha 3, 46 kDa antibody|Gja3 antibody - Gen-ID
- 2700
- UniProt
- Q9Y6H8
-