GJA3 Antikörper (N-Term)

Produktnummer ABIN634674

Produktdetails anti-GJA3 Antikörper

Target: GJA3 (Gap Junction Protein, alpha 3, 46kDa (GJA3))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GJA3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GJA3 antibody was raised against the N terminal of GJA3

Aufreinigung: Affinity purified

Immunogen: GJA3 antibody was raised using the N terminal of GJA3 corresponding to a region with amino acids ISHIRFWALQIIFVSTPTLIYLGHVLHIVRMEEKKKEREEEEQLKRESPS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GJA3 Blocking Peptide, catalog no. 33R-4153, is also available for use as a blocking control in assays to test for specificity of this GJA3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GJA3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GJA3

Target: GJA3 (Gap Junction Protein, alpha 3, 46kDa (GJA3))

Andere Bezeichnung: GJA3 (GJA3 Produkte)

Synonyme: cx46 antikoerper, MGC53082 antikoerper, czp3 antikoerper, Cx44 antikoerper, cx48.5 antikoerper, Cnx46 antikoerper, Cx43 antikoerper, Cx46 antikoerper, Gja-3 antikoerper, CTRCT14 antikoerper, CX46 antikoerper, CZP3 antikoerper, MGC69466 protein L homeolog antikoerper, gap junction protein alpha 3 antikoerper, gap junction protein, alpha 3 antikoerper, MGC69466.L antikoerper, gja3 antikoerper, GJA3 antikoerper, Gja3 antikoerper

Hintergrund: GJA3 belongs to the connexin family. One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell. Defects in GJA3 are the cause of zonular pulverulent cataract type 3 (CZP3).

Molekulargewicht: 47 kDa (MW of target protein)