Der Kaninchen Polyklonal anti-ACTH Antikörper wird verwendet zum Nachweis von ACTH in Proben von Human, Ratte und Maus. Er wurde validiert für IHC (p).
An amino acid sequence from the middle region of human Adrenocorticotropic hormone (SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF) was used as the immunogen for this ACTH antibody.
The stated application concentrations are suggested starting amounts. Titration of the ACTH antibody may be required due to differences in protocols and secondary/substrate sensitivity.\. IHC (Paraffin): 0.5-1 μg/mL
Beschränkungen
Nur für Forschungszwecke einsetzbar
Buffer
0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
Lagerung
-20 °C
Informationen zur Lagerung
After reconstitution, the ACTH antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Target
ACTH
(Adrenocorticotropic hormone (ACTH))
Andere Bezeichnung
ACTH
Substanzklasse
Hormone
Hintergrund
Adrenocorticotropic hormone (ACTH), also known as Corticotropin, is a polypeptide tropic hormone produced and secreted by the anterior pituitary gland. It is an important component of the hypothalamic-pituitary-adrenal axis and is often produced in response to biological stress (along with its precursor corticotropin-releasing hormone from the hypothalamus). Its principal effects are increased production and release of corticosteroids. ACTH stimulates secretion of glucocorticoid steroid hormones from adrenal cortex cells, especially in the zona fasciculata of the adrenal glands. This gene can influence steroid hormone secretion by both rapid short-term mechanisms that take place within minutes and slower long-term actions. Besides, ACTH also enhances transcription of mitochondrial genes that encode for subunits of mitochondrial oxidative phosphorylation systems.