VEGFA Antikörper

Produktnummer ABIN2629817

Produktdetails anti-VEGFA Antikörper

Target: VEGFA (Vascular Endothelial Growth Factor A (VEGFA))

Reaktivität: Human, Ratte, Maus, Schwein, Hund, Kaninchen, Huhn, Rind (Kuh), Schaf, Meerschweinchen, Pferd, Affe, Cat, Esel, Ziege, Hamster

Wirt: Ziege

Klonalität: Polyklonal

Konjugat: Dieser VEGFA Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunofluorescence (IF)

Spezifität: Detects endogenous levels of total VEGFA by Western blot in whole cell and tissue lysates.

Aufreinigung: Immunoaffinity purified

Immunogen: Purified recombinant human VEGFA isoform 6 produced in E. coli. corresponding to P15692-6 (MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVD)

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Approved: IF (1:50 - 1:250), WB (1:500 - 1:2000)

Kommentare:

Target Species of Antibody: Human

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Liquid

Konzentration: Lot specific

Buffer: PBS, 20 % glycerol, 0.05 % sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Details zu VEGFA

Target: VEGFA (Vascular Endothelial Growth Factor A (VEGFA))

Andere Bezeichnung: VEGFA / VEGF (VEGFA Produkte)

Synonyme: MVCD1 antikoerper, VEGF antikoerper, VPF antikoerper, Vegf antikoerper, Vegf120 antikoerper, Vegf164 antikoerper, Vegf188 antikoerper, Vpf antikoerper, vegf antikoerper, vegfa antikoerper, wu:fj82c06 antikoerper, VEGF-A antikoerper, VEGF164 antikoerper, eVEGF120 antikoerper, eVEGF164 antikoerper, vegf-a antikoerper, vpf antikoerper, vefg antikoerper, si:dkey-14d8.3 antikoerper, wu:fd42e02 antikoerper, vascular endothelial growth factor A antikoerper, vascular endothelial growth factor Aa antikoerper, vascular endothelial growth factor A L homeolog antikoerper, vascular endothelial growth factor Ab antikoerper, VEGFA antikoerper, Vegfa antikoerper, vegfaa antikoerper, vegfa.L antikoerper, vegfa antikoerper, vegfab antikoerper

Hintergrund: Name/Gene ID: VEGFA
Family: PDGF

Synonyms: VEGFA, VPF, Vascular permeability factor, VEGF, VEGF-A, MVCD1

Gen-ID: 7422

UniProt: P15692

Pathways: RTK Signalweg, Glycosaminoglycan Metabolic Process, Regulation of Cell Size, Tube Formation, Signaling Events mediated by VEGFR1 and VEGFR2, Platelet-derived growth Factor Receptor Signaling, VEGFR1 Specific Signals, VEGF Signaling