VEGFA Antikörper

Produktnummer ABIN2629817

Der Ziege Polyklonal anti-VEGFA Antikörper (ABIN2629817) detektiert spezifisch VEGFA in WB und IF. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Ratte, Maus, Schwein, Hund, Kaninchen, Rind (Kuh), Huhn, Schaf, Pferd, Meerschweinchen, Affe, Cat, Esel, Ziege und Hamster.

Kurzübersicht für VEGFA Antikörper (ABIN2629817)

Target: VEGFA (Vascular Endothelial Growth Factor A (VEGFA))

Reaktivität: Human, Ratte, Maus, Schwein, Hund, Kaninchen, Rind (Kuh), Huhn, Schaf, Pferd, Meerschweinchen, Affe, Cat, Esel, Ziege, Hamster

Wirt: Ziege

Klonalität: Polyklonal

Konjugat: Dieser VEGFA Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunofluorescence (IF)

Produktdetails anti-VEGFA Antikörper

Spezifität: Detects endogenous levels of total VEGFA by Western blot in whole cell and tissue lysates.

Aufreinigung: Immunoaffinity purified

Immunogen: Purified recombinant human VEGFA isoform 6 produced in E. coli. corresponding to P15692-6 (MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVD)

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Approved: IF (1:50 - 1:250), WB (1:500 - 1:2000)

Kommentare:

Target Species of Antibody: Human

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Liquid

Konzentration: Lot specific

Buffer: PBS, 20 % glycerol, 0.05 % sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Details zu VEGFA

Target: VEGFA (Vascular Endothelial Growth Factor A (VEGFA))

Andere Bezeichnung: VEGFA / VEGF

Hintergrund: Name/Gene ID: VEGFA
Family: PDGF

Synonyms: VEGFA, VPF, Vascular permeability factor, VEGF, VEGF-A, MVCD1

Gen-ID: 7422

UniProt: P15692

Pathways: RTK Signalweg, Glycosaminoglycan Metabolic Process, Regulation of Cell Size, Tube Formation, Signaling Events mediated by VEGFR1 and VEGFR2, Platelet-derived growth Factor Receptor Signaling, VEGFR1 Specific Signals, VEGF Signaling