TLR8 Antikörper (N-Term)

Produktnummer ABIN2153307

Der Ziege Polyklonal anti-TLR8 Antikörper (ABIN2153307) detektiert spezifisch TLR8 in WB und IHC. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für TLR8 Antikörper (N-Term) (ABIN2153307)

Target: TLR8 (Toll-Like Receptor 8 (TLR8))

Reaktivität: Human

Wirt: Ziege

Klonalität: Polyklonal

Konjugat: Dieser TLR8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-TLR8 Antikörper

Bindungsspezifität: AA 81-109, N-Term

Aufreinigung: TLR8 antibody was purified by affinity chromatography

Immunogen: TLR8 antibody was raised in Goat using 30 amino acid (aa)synthetic peptide CESFQGLQNLTKINLNHNPNVQHQNGNPGI corresponding to aa 81-109 of the N-terminal domain of Human TLR8 as the immunogen

Anwendungsinformationen

Applikationshinweise: IHC: 1:125, WB: 1:500

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Konzentration: Lot specific

Buffer: 10 mM KHPO4, 140 mM NaCl with 0.1 % sodium azide

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freeze/thaw cycles

Lagerung: -20 °C

Informationen zur Lagerung: Aliquot and freeze at -20 °C

Details zu TLR8

Target: TLR8 (Toll-Like Receptor 8 (TLR8))

Andere Bezeichnung: TLR8

Pathways: TLR Signalweg, Activation of Innate immune Response, Toll-Like Receptors Cascades