IL21 Receptor Antikörper (AA 35-64)
-
- Target Alle IL21 Receptor (IL21R) Antikörper anzeigen
- IL21 Receptor (IL21R) (Interleukin 21 Receptor (IL21R))
-
Bindungsspezifität
- AA 35-64
-
Reaktivität
- Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser IL21 Receptor Antikörper ist unkonjugiert
-
Applikation
- ELISA, Immunohistochemistry (IHC), Flow Cytometry (FACS)
- Spezifität
- Peptide sequence is <50 % identical to other sequences in GenBank. The antibody recognizes mouse IL-21 receptor. Not tested for cross-reactivity to human IL-21 receptor.
- Homologie
- Percent identity by BLAST analysis: Mouse (100%) Rat (90%).
- Aufreinigung
- Immunoaffinity purified
- Immunogen
-
Synthetic peptide CVLETRSPNPSILSLTWQDEYEELQDQETF corresponding to 35-65 residues of N-terminus of mouse IL-21 receptor. Percent identity by BLAST analysis: Mouse (100%), Rat (90%).
Type of Immunogen: Synthetic peptide - Top Product
- Discover our top product IL21R Primärantikörper
-
anti-Interleukin 21 Receptor (IL21R) (AA 20-232) antibody
IL21R Reaktivität: Human ELISA, FACS Wirt: Maus Monoclonal 8H10G4D12 unconjugated
anti-Interleukin 21 Receptor (IL21R) (AA 20-240) antibodyIL21R Reaktivität: Human WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Interleukin 21 Receptor (IL21R) (AA 441-538) antibodyIL21R Reaktivität: Maus WB, ELISA, IF (cc), IF (p), IHC (p), IHC (fro) Wirt: Kaninchen Polyclonal unconjugated
anti-Interleukin 21 Receptor (IL21R) (AA 20-240) antibodyIL21R Reaktivität: Human ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Interleukin 21 Receptor (IL21R) (AA 131-165) antibodyIL21R Reaktivität: Human WB Wirt: Kaninchen Polyclonal RB54166 unconjugated
anti-Interleukin 21 Receptor (IL21R) (AA 65-80) antibodyIL21R Reaktivität: Human, Affe WB, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Interleukin 21 Receptor (IL21R) antibodyIL21R Reaktivität: Human ELISA, FACS Wirt: Kaninchen Chimeric unconjugated Fc fragment
anti-Interleukin 21 Receptor (IL21R) (AA 23-185) antibodyIL21R Reaktivität: Human WB, IHC, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Interleukin 21 Receptor (IL21R) antibodyIL21R Reaktivität: Human FACS, CyTOF Wirt: Maus Monoclonal 2G1-K12 unconjugated
anti-Interleukin 21 Receptor (IL21R) antibody (PE)IL21R Reaktivität: Human FACS Wirt: Maus Monoclonal 17A12 PE
-
- Applikationshinweise
- Approved: ELISA (1:100000), Flo, IHC
- Kommentare
-
Target Species of Antibody: Mouse
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Liquid
- Konzentration
- Lot specific
- Buffer
- 10 mM KHPO4, 140 mM NaCl with 1 mg/mL BSA and 0.1 % sodium azide
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Aliquot to Avoid freeze/thaw cycles.
- Lagerung
- -20 °C
- Informationen zur Lagerung
- Store at -20°C. Aliquot to avoid freeze/thaw cycles.
-
- Target
- IL21 Receptor (IL21R) (Interleukin 21 Receptor (IL21R))
- Andere Bezeichnung
- IL21R / IL-21R (IL21R Produkte)
- Hintergrund
-
Name/Gene ID: IL21R
Family: Interleukin
Synonyms: IL21R, CD360, Interleukin 21 receptor, Interleukin-21 receptor, NILR, IL-21 receptor, CD360 antigen, IL-21R, IL21 Receptor, Novel interleukin receptor - Gen-ID
- 50615
- UniProt
- Q9HBE5
- Pathways
- JAK-STAT Signalweg
-
