IL21 Receptor Antikörper (AA 35-64)

Produktnummer ABIN1905061

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch IL21 Receptor in ELISA, IHC und FACS. Er zeigt eine Reaktivität gegenüber Maus.

Kurzübersicht für IL21 Receptor Antikörper (AA 35-64) (ABIN1905061)

Target: IL21 Receptor (IL21R) (Interleukin 21 Receptor (IL21R))

Reaktivität: Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IL21 Receptor Antikörper ist unkonjugiert

Applikation: ELISA, Immunohistochemistry (IHC), Flow Cytometry (FACS)

Produktdetails anti-IL21 Receptor Antikörper

Bindungsspezifität: AA 35-64

Spezifität: Peptide sequence is <50 % identical to other sequences in GenBank. The antibody recognizes mouse IL-21 receptor. Not tested for cross-reactivity to human IL-21 receptor.

Homologie: Percent identity by BLAST analysis: Mouse (100%) Rat (90%).

Aufreinigung: Immunoaffinity purified

Immunogen: Synthetic peptide CVLETRSPNPSILSLTWQDEYEELQDQETF corresponding to 35-65 residues of N-terminus of mouse IL-21 receptor. Percent identity by BLAST analysis: Mouse (100%), Rat (90%).

Type of Immunogen: Synthetic peptide

Anwendungsinformationen

Applikationshinweise: Approved: ELISA (1:100000), Flo, IHC

Kommentare:

Target Species of Antibody: Mouse

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Liquid

Konzentration: Lot specific

Buffer: 10 mM KHPO4, 140 mM NaCl with 1 mg/mL BSA and 0.1 % sodium azide

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Aliquot to Avoid freeze/thaw cycles.

Lagerung: -20 °C

Informationen zur Lagerung: Store at -20°C. Aliquot to avoid freeze/thaw cycles.

Details zu IL21 Receptor

Target: IL21 Receptor (IL21R) (Interleukin 21 Receptor (IL21R))

Andere Bezeichnung: IL21R / IL-21R

Hintergrund: Name/Gene ID: IL21R
Family: Interleukin

Synonyms: IL21R, CD360, Interleukin 21 receptor, Interleukin-21 receptor, NILR, IL-21 receptor, CD360 antigen, IL-21R, IL21 Receptor, Novel interleukin receptor

Gen-ID: 50615

UniProt: Q9HBE5

Pathways: JAK-STAT Signalweg