MYD88 Antikörper

Produktnummer ABIN634396

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch MYD88 in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für MYD88 Antikörper (ABIN634396)

Target: MYD88 (Myeloid Differentiation Primary Response Gene (88) (MYD88))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MYD88 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MYD88 Antikörper

Aufreinigung: Affinity purified

Immunogen: MYD88 antibody was raised using a synthetic peptide corresponding to a region with amino acids TCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MYD88 Blocking Peptide, (ABIN5614890), is also available for use as a blocking control in assays to test for specificity of this MYD88 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MYD88 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MYD88

Target: MYD88 (Myeloid Differentiation Primary Response Gene (88) (MYD88))

Andere Bezeichnung: MYD88

Hintergrund: This gene encodes a cytosolic adapter protein that plays a central role in the innate and adaptive immune response. This protein functions as an essential signal transducer in the interleukin-1 and Toll-like receptor signaling pathways.

Molekulargewicht: 33 kDa (MW of target protein)

Pathways: NF-kappaB Signalweg, TLR Signalweg, Neurotrophin Signalübertragung, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response, Toll-Like Receptors Cascades