ERK1 Antikörper (Middle Region)

Produktnummer ABIN634147

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch ERK1 in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für ERK1 Antikörper (Middle Region) (ABIN634147)

Target: ERK1 (MAPK3) (Mitogen-Activated Protein Kinase 3 (MAPK3))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ERK1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ERK1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: MAPK3 antibody was raised against the middle region of MAPK3

Aufreinigung: Affinity purified

Immunogen: MAPK3 antibody was raised using the middle region of MAPK3 corresponding to a region with amino acids EALAHPYLEQYYDPTDEPVAEEPFTFAMELDDLPKERLKELIFQETARFQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MAPK3 Blocking Peptide, (ABIN937651), is also available for use as a blocking control in assays to test for specificity of this MAPK3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAPK3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ERK1

Target: ERK1 (MAPK3) (Mitogen-Activated Protein Kinase 3 (MAPK3))

Andere Bezeichnung: MAPK3

Hintergrund: The protein encoded by this gene is a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act in a signaling cascade that regulates various cellular processes such as proliferation and differentiation.

Molekulargewicht: 43 kDa (MW of target protein)

Pathways: MAPK Signalweg, RTK Signalweg, Interferon-gamma Pathway, Fc-epsilon Rezeptor Signalübertragung, Neurotrophin Signalübertragung, Response to Growth Hormone Stimulus, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Hepatitis C, Protein targeting to Nucleus, Toll-Like Receptors Cascades, Signaling Events mediated by VEGFR1 and VEGFR2, Signaling of Hepatocyte Growth Factor Receptor, VEGFR1 Specific Signals, S100 Proteine