X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 4 (XRCC4) Antikörper

Antigen: X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 4 (XRCC4)

Synonyme: AW413319, AW545101, 2310057B22Rik, MGC95022, MGC73312, zgc:73312, MGC81443, XRCC4, MGC148661, DKFZp469B0634

Klonalität: Polyklonal

Wirt: Kaninchen

Applikation: Western Blot (WB)

Produktnummer: ABIN630879

Produktbeschreibung

Weitere Bezeichnung: XRCC4

Immunogen: XRCC4 antibody was raised using the middle region of XRCC4 corresponding to a region with amino acids LQKENERLLRDWNDVQGRFEKCVSAKEALETDLYKRFILVLNEKKTKIRS

Beschreibung: XRCC4 functions together with DNA ligase IV and the DNA-dependent protein kinase in the repair of DNA double-strand break by non-homologous end joining and the completion of V(D)J recombination events. The non-homologous end-joining pathway is required both for normal development and for suppression of tumors. This gene functionally complements XR-1 Chinese hamster ovary cell mutant, which is impaired in DNA double-strand breaks produced by ionizing radiation and restriction enzymes.

Molekulargewicht: 38 kDa (MW of target protein)

Anwendungen

Konzentration: 1 mg/ml

Reinigung: Affinity purified

Buffer: Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of XRCC4 antibody in PBS

Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.

Forschungsgebiet: Chromatin und nukleäre Signaltransduktion, DNS/RNS

Beschränkungen: Nur für Forschungszwecke einsetzbar