XRCC4 Antikörper (Middle Region)

Produktnummer ABIN630879

Der Kaninchen Polyklonal anti-XRCC4 Antikörper (ABIN630879) detektiert spezifisch XRCC4 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für XRCC4 Antikörper (Middle Region) (ABIN630879)

Target: XRCC4 (X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 4 (XRCC4))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser XRCC4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-XRCC4 Antikörper

Bindungsspezifität: Middle Region

Spezifität: XRCC4 antibody was raised against the middle region of XRCC4

Aufreinigung: Affinity purified

Immunogen: XRCC4 antibody was raised using the middle region of XRCC4 corresponding to a region with amino acids LQKENERLLRDWNDVQGRFEKCVSAKEALETDLYKRFILVLNEKKTKIRS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

XRCC4 Blocking Peptide, (ABIN5617046), is also available for use as a blocking control in assays to test for specificity of this XRCC4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of XRCC4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu XRCC4

Target: XRCC4 (X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 4 (XRCC4))

Andere Bezeichnung: XRCC4

Hintergrund: XRCC4 functions together with DNA ligase IV and the DNA-dependent protein kinase in the repair of DNA double-strand break by non-homologous end joining and the completion of V(D)J recombination events. The non-homologous end-joining pathway is required both for normal development and for suppression of tumors. This gene functionally complements XR-1 Chinese hamster ovary cell mutant, which is impaired in DNA double-strand breaks produced by ionizing radiation and restriction enzymes.

Molekulargewicht: 38 kDa (MW of target protein)

Pathways: DNA Reparatur, Production of Molecular Mediator of Immune Response