XRCC6 Antikörper (N-Term)

Produktnummer ABIN629623

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch XRCC6 in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für XRCC6 Antikörper (N-Term) (ABIN629623)

Target: XRCC6 (X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 6 (XRCC6))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser XRCC6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-XRCC6 Antikörper

Bindungsspezifität: N-Term

Spezifität: G22 P1 antibody was raised against the N terminal Of G22 1

Aufreinigung: Purified

Immunogen: G22 P1 antibody was raised using the N terminal Of G22 1 corresponding to a region with amino acids MSGWESYYKTEGDEEAEEEQEENLEASGDYKYSGRDSLIFLVDASKAMFE

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

G22P1 Blocking Peptide, (ABIN5613681), is also available for use as a blocking control in assays to test for specificity of this G22P1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of G20 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu XRCC6

Target: XRCC6 (X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 6 (XRCC6))

Andere Bezeichnung: G22P1

Hintergrund: The p70/p80 autoantigen is a nuclear complex consisting of two subunits with molecular masses of approximately 70 and 80 kDa. The complex functions as a single-stranded DNA-dependent ATP-dependent helicase. The complex may be involved in the repair of nonhomologous DNA ends such as that required for double-strand break repair, transposition, and V(D)J recombination. High levels of autoantibodies to p70 and p80 have been found in some patients with systemic lupus erythematosus.

Molekulargewicht: 70 kDa (MW of target protein)

Pathways: DNA Reparatur