NOX3 Antikörper

Produktnummer ABIN8106196

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch NOX3 in IHC. Es zeigt Reaktivität gegenüber Proben von Human, Maus, Ratte, Rind (Kuh), Hund, Meerschweinchen, Pferd, Schwein und Kaninchen.

Kurzübersicht für NOX3 Antikörper (ABIN8106196)

Target: NOX3 (NADPH Oxidase 3 (NOX3))

Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Meerschweinchen, Pferd, Schwein, Kaninchen

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NOX3 Antikörper ist unkonjugiert

Applikation: Immunohistochemistry (IHC)

Produktdetails anti-NOX3 Antikörper

Verwendungszweck: NOX3 Antibody

Sequenz: KQIAYNHPSS SIGVFFCGPK ALSRTLQKMC HLYSSADPRG VHFYYNKESF

Homologie: Cow: 100%, Dog: 100%, Guinea Pig: 93%, Horse: 100%, Human: 100%, Mouse: 92%, Pig: 100%, Rabbit: 100%, Rat: 92%

Aufreinigung: Affinity Purified

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence KQIAYNHPSSSIGVFFCGPKALSRTLQKMCHLYSSADPRGVHFYYNKESF

Anwendungsinformationen

Applikationshinweise: Optimal working dilution should be determined by the investigator.

Kommentare:

We also sell a specific blocking peptide that can be used in combination with this antibody. You can find the blocking peptide under AAP47185-100UG

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Liquid

Konzentration: 0.5 mg/mL

Buffer: Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: prevent freeze-thaw cycles

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20 °C in small aliquots to prevent freeze-thaw cycles.

Details zu NOX3

Target: NOX3 (NADPH Oxidase 3 (NOX3))

Andere Bezeichnung: NOX3

Hintergrund:

Background Information: This gene encodes a member of the NOX family of NADPH oxidases. These enzymes have the capacity to generate superoxide and other reactive oxygen species (ROS) and transport electrons across the plasma membrane. The ROS generated by family members have been implicated in numerous biological functions including host defense, posttranlational processing of proteins, cellular signaling, regulation of gene expression, and cell differentiation. The protein encoded by this gene is expressed predominantly in the inner ear and is involved in the biogenesis of otoconia/otolith, which are crystalline structures of the inner ear involved in the perception of gravity.

Gene Name: NADPH oxidase 3

Alternative Symbols: MOX-2, GP91-3

Protein Name: NADPH oxidase 3

Molekulargewicht: 65 kDa

Gen-ID: 50508

NCBI Accession: NP_056533

UniProt: Q9HBY0