CDKN2C Antikörper

Produktnummer ABIN8098208

Der Kaninchen Polyklonal anti-CDKN2C Antikörper wird verwendet zum Nachweis von CDKN2C in Proben von Human, Maus, Ratte, Hund, Rind (Kuh), Meerschweinchen, Pferd, Schwein und Kaninchen. Er wurde validiert für IHC.

Kurzübersicht für CDKN2C Antikörper (ABIN8098208)

Target: CDKN2C (Cyclin-Dependent Kinase Inhibitor 2C (p18, Inhibits CDK4) (CDKN2C))

Reaktivität: Human, Maus, Ratte, Hund, Rind (Kuh), Meerschweinchen, Pferd, Schwein, Kaninchen

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CDKN2C Antikörper ist unkonjugiert

Applikation: Immunohistochemistry (IHC)

Produktdetails anti-CDKN2C Antikörper

Verwendungszweck: CDKN2C Antibody

Sequenz: VMKLGNPEIA RRLLLRGANP DLKDRTGFAV IHDAARAGFL DTLQTLLEFQ

Homologie: Cow: 100%, Dog: 100%, Guinea Pig: 92%, Horse: 100%, Human: 100%, Mouse: 91%, Pig: 100%, Rabbit: 100%, Rat: 92%

Aufreinigung: Affinity Purified

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence VMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQ

Anwendungsinformationen

Applikationshinweise: Optimal working dilution should be determined by the investigator.

Kommentare:

We also sell a specific blocking peptide that can be used in combination with this antibody. You can find the blocking peptide under AAP30196-100UG

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Liquid

Konzentration: 0.5 mg/mL

Buffer: Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: prevent freeze-thaw cycles

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20 °C in small aliquots to prevent freeze-thaw cycles.

Details zu CDKN2C

Target: CDKN2C (Cyclin-Dependent Kinase Inhibitor 2C (p18, Inhibits CDK4) (CDKN2C))

Andere Bezeichnung: CDKN2C

Hintergrund:

Background Information: The protein encoded by this gene is a member of the INK4 family of cyclin-dependent kinase inhibitors. This protein has been shown to interact with CDK4 or CDK6, and prevent the activation of the CDK kinases, thus function as a cell growth regulator that controls cell cycle G1 progression. Ectopic expression of this gene was shown to suppress the growth of human cells in a manner that appears to correlate with the presence of a wild-type RB1 function. Studies in the knockout mice suggested the roles of this gene in regulating spermatogenesis, as well as in suppressing tumorigenesis. Two alternatively spliced transcript variants of this gene, which encode an identical protein, have been reported.

Gene Name: cyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4)

Alternative Symbols: p18, INK4C, p18-INK4C

Protein Name: Cyclin-dependent kinase 4 inhibitor C

Molekulargewicht: 18 kDa

Gen-ID: 1031

NCBI Accession: NP_001253

UniProt: P42773

Pathways: Zellzyklus, Mitotic G1-G1/S Phases