Aquaporin 4 Antikörper (C-Term, Intracellular)

Produktnummer ABIN7884767

Der Kaninchen Polyklonal anti-Aquaporin 4 Antikörper (ABIN7884767) detektiert spezifisch Aquaporin 4 in WB, IHC, IF, FACS und IC. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus und Ratte.

Kurzübersicht für Aquaporin 4 Antikörper (C-Term, Intracellular) (ABIN7884767)

Target: Aquaporin 4 (AQP4)

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Aquaporin 4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC), Immunofluorescence (IF), Flow Cytometry (FACS), Immunochromatography (IC)

Güteklasse: Carrier-free, KO Validated

Produktdetails anti-Aquaporin 4 Antikörper

Bindungsspezifität: AA 249-323, C-Term, Intracellular

Verwendungszweck: A Rabbit Polyclonal Antibody to Aquaporin 4 (249-323) Channel

Homologie: Mouse - 73,75 amino acid residues identical, human - 69, bovine - 71, rabbit - 64

Aufreinigung: The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.

Immunogen: GST fusion protein with the sequence EYVFCPDVELKRRLKEAFSKAAQQTKGSYMEVEDNRSQVETEDLILKPGVVHVIDIDRGDEKKGKDSSGEVLSSV, corresponding to amino acid residues 249-323 of rat AQP4

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise:

WB: 1:1000

FC: The optimal concentration should be determined by the user

ICC: The optimal concentration should be determined by the user

IHC: The optimal concentration should be determined by the user

IP: The optimal concentration should be determined by the user

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: 0.2 mL double distilled water (DDW)

Konzentration: 1 mg/mL

Buffer: PBS pH 7.4

Konservierungsmittel: Without preservative

Lagerung: -20 °C

Informationen zur Lagerung: The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C

Details zu Aquaporin 4

Target: Aquaporin 4 (AQP4)

Andere Bezeichnung: WCH4

Hintergrund:

Synonyms: WCH4, Mercurial-insensitive water channel

Description: Aquaporin 4 (AQP-4) belongs to a family of membrane proteins that allow passage of water and certain solutes through biological membranes. The family is composed of 13 members (AQP-0 to AQP-12).The aquaporins can be divided into two functional groups based on their permeability characteristics: the aquaporins that are only permeated by water and the aquaglyceroporins that are permeated by water and other small solutes such as glycerol. AQP-4 together with AQP-1, AQP-2 and AQP-5 belong to the first group1. Little is known about the function of the two newest members, AQP-11 and AQP-12.The proteins present a conserved structure of six transmembrane domains with intracellular N- and C-termini. The functional channel is a tetramer but each subunit has a separate pore and therefore the functional channel unit, contains four pores1.AQP-4 is the major membrane water channel in the central nervous system. The channel is expressed in astrocyte foot processes in direct contact with capillary vessels in the brain suggesting a role in water transport under normal and pathological conditions. Indeed, transgenic mice lacking AQP-4 have reduced brain swelling and improved neurological outcome following water intoxication and focal cerebral ischemia. In contrast, brain swelling and clinical outcome are worse in AQP-4-null mice in models of vasogenic (fluid leak) edema caused by freeze-injury and brain tumor, probably due to impaired AQP-4-dependent brain water clearance2.In addition, it has been recently shown that neuromyelitis optica (NMO), an inflammatory demyelinating disease that selectively affects optic nerves and spinal cord, is caused by the development of an autoantibody directed against AQP-43.

Gen-ID: 25293

UniProt: P47863

Pathways: Sensory Perception of Sound