ZEB1 Antikörper

Produktnummer ABIN7882724

Der Kaninchen Polyklonal anti-ZEB1 Antikörper (ABIN7882724) detektiert spezifisch ZEB1 in WB, IF, FACS und IHC (p). Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für ZEB1 Antikörper (ABIN7882724)

Target: ZEB1 (Zinc Finger E-Box Binding Homeobox 1 (ZEB1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ZEB1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunofluorescence (IF), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Produktdetails anti-ZEB1 Antikörper

Verwendungszweck: ZEB1 Antibody

Sequenz: LLKAYYALNA QPSAEELSKI ADSVNLPLDV VKKWFEKMQ

Aufreinigung: Affinity purified

Immunogen: Amino acids LLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQ were used as the immunogen for the ZEB1 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the ZEB1 antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the ZEB1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu ZEB1

Target: ZEB1 (Zinc Finger E-Box Binding Homeobox 1 (ZEB1))

Andere Bezeichnung: ZEB1

Hintergrund: Zinc finger E-box-binding homeobox 1 is a protein that in humans is encoded by the ZEB1 gene. It is mapped to 10p11.22. This gene encodes a zinc finger transcription factor. The encoded protein likely plays a role in transcriptional repression of interleukin 2. Mutations in this gene have been associated with posterior polymorphous corneal dystrophy-3 and late-onset Fuchs endothelial corneal dystrophy. Alternatively spliced transcript variants encoding different isoforms have been described.

UniProt: P37275

Pathways: Regulation of Muscle Cell Differentiation