ZEB1 Antikörper

Produktnummer ABIN7882723

Der Maus Monoklonal anti-ZEB1 Antikörper wird verwendet zum Nachweis von ZEB1 in Proben von Human, Maus und Ratte. Er wurde validiert für WB und IHC (p).

Kurzübersicht für ZEB1 Antikörper (ABIN7882723)

Target: ZEB1 (Zinc Finger E-Box Binding Homeobox 1 (ZEB1))

Reaktivität: Human, Maus, Ratte

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser ZEB1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Klon: 8B12D1

Produktdetails anti-ZEB1 Antikörper

Verwendungszweck: TCF-8 Antibody / ZEB1 / AREB6

Sequenz: LLKAYYALNA QPSAEELSKI ADSVNLPLDV VKKWFEKMQ

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids LLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQ were used as the immunogen for the TCF-8 antibody.

Isotyp: IgG2b

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the TCF-8 antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the TCF-8 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu ZEB1

Target: ZEB1 (Zinc Finger E-Box Binding Homeobox 1 (ZEB1))

Andere Bezeichnung: TCF-8

Hintergrund: ZEB1 (Zinc Finger E Box-Binding Homeobox 1), also called TCF8, AREB6, NIL2A or DELTA-EF1, is a protein that in humans is encoded by the ZEB1 gene. Fluorescence in situ hybridization localized the ZEB1 gene to chromosome 10p11.2. Krafchak et al. (2005) demonstrated a complex (core plus secondary) binding site for TCF8 in the promoter of the COL4A3 gene, mutant in Alport syndrome and which encodes collagen type IV alpha-3. They detected expression of TCF8 in cornea. Nishimura et al. (2006) found that delta-Ef1 was upregulated during differentiation in a mouse smooth muscle cell (SMC) line.

UniProt: P37275

Pathways: Regulation of Muscle Cell Differentiation