YY1 Antikörper

Produktnummer ABIN7882718

Der Maus Monoklonal anti-YY1 Antikörper (Klon 6H3E1) (ABIN7882718) detektiert spezifisch YY1 in WB, IHC (p) und FACS. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus und Ratte.

Kurzübersicht für YY1 Antikörper (ABIN7882718)

Target: YY1 (YY1 Transcription Factor (YY1))

Reaktivität: Human, Maus, Ratte

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser YY1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Flow Cytometry (FACS)

Klon: 6H3E1

Produktdetails anti-YY1 Antikörper

Verwendungszweck: Yin and yang 1 Antibody / YY1

Sequenz: EQKQVQIKTL EGEFSVTMWS SDEKKDIDHE TVVEEQ

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids EQKQVQIKTLEGEFSVTMWSSDEKKDIDHETVVEEQ were used as the immunogen for the Yin and yang 1 antibody.

Isotyp: IgG2b

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the Yin and yang 1 antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the Yin and yang 1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu YY1

Target: YY1 (YY1 Transcription Factor (YY1))

Andere Bezeichnung: Yin and yang 1

Hintergrund: YY1 (Yin Yang 1) is a transcriptional repressor protein in humans that is encoded by the YY1 gene. YY1 is a ubiquitously distributed transcription factor belonging to the GLI-Kruppel class of zinc finger proteins. The protein is involved in repressing and activating a diverse number of promoters. YY1 may direct histone deacetylases and histone acetyltransferases to a promoter in order to activate or repress the promoter, thus implicating histone modification in the function of YY1.

UniProt: P25490