YY1 Antikörper

Produktnummer ABIN7882716

Dieser Maus Monoklonal Antikörper detektiert spezifisch YY1 in WB, IF, IHC (p) und FACS. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für YY1 Antikörper (ABIN7882716)

Target: YY1 (YY1 Transcription Factor (YY1))

Reaktivität: Human, Maus, Ratte

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser YY1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Flow Cytometry (FACS)

Klon: 3F3E7

Produktdetails anti-YY1 Antikörper

Verwendungszweck: YY1 Antibody

Sequenz: EQKQVQIKTL EGEFSVTMWS SDEKKDIDHE TVVEEQ

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids EQKQVQIKTLEGEFSVTMWSSDEKKDIDHETVVEEQ were used as the immunogen for the YY1 antibody.

Isotyp: IgG1

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the YY1 antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the YY1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu YY1

Target: YY1 (YY1 Transcription Factor (YY1))

Andere Bezeichnung: YY1

Hintergrund: YY1 (Yin Yang 1) is a transcriptional repressor protein in humans that is encoded by the YY1 gene. YY1 is a ubiquitously distributed transcription factor belonging to the GLI-Kruppel class of zinc finger proteins. The protein is involved in repressing and activating a diverse number of promoters. YY1 may direct histone deacetylases and histone acetyltransferases to a promoter in order to activate or repress the promoter, thus implicating histone modification in the function of YY1.

UniProt: P25490