CCDC90A Antikörper

Produktnummer ABIN7881645

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch CCDC90A in WB und IHC (p). Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für CCDC90A Antikörper (ABIN7881645)

Target: CCDC90A (MCUR1) (Mitochondrial Calcium Uniporter Regulator 1 (MCUR1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CCDC90A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Produktdetails anti-CCDC90A Antikörper

Verwendungszweck: MCUR1 Antibody / Mitochondrial calcium uniporter regulator 1

Sequenz: ATQQAEIIVS ALVKILEANM DIVYKDMVTK MQQE

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids ATQQAEIIVSALVKILEANMDIVYKDMVTKMQQE from the human protein were used as the immunogen for the MCUR1 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the MCUR1 antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the MCUR1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu CCDC90A

Target: CCDC90A (MCUR1) (Mitochondrial Calcium Uniporter Regulator 1 (MCUR1))

Andere Bezeichnung: MCUR1

Hintergrund: MCUR1 is an inner mitochondrial membrane protein that has been shown to function as a component of the mitochondrial Ca(2+) uniporter, in the assembly of mitochondrial respiratory complex IV, and in mitochondrial permeability transition (MPT). The MCUR1 gene is mapped to chromosome 6p23 based on an alignment of the MCUR1 sequence with the genomic sequence.

UniProt: Q96AQ8