HAS1 Antikörper

Produktnummer ABIN7881135

Der Kaninchen Polyklonal anti-HAS1 Antikörper wird verwendet zum Nachweis von HAS1 in Proben von Human, Maus und Ratte. Er wurde validiert für WB, ICC, IF und IHC (p).

Kurzübersicht für HAS1 Antikörper (ABIN7881135)

Target: HAS1 (Hyaluronan Synthase 1 (HAS1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HAS1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Produktdetails anti-HAS1 Antikörper

Verwendungszweck: HAS1 Antibody / Hyaluronan synthase 1

Sequenz: NRAEDLYMVD MFREVFADED PATYVWDGNY HQPWEPA

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids NRAEDLYMVDMFREVFADEDPATYVWDGNYHQPWEPA were used as the immunogen for the HAS1 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the HAS1 antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the HAS1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu HAS1

Target: HAS1 (Hyaluronan Synthase 1 (HAS1))

Andere Bezeichnung: HAS1

Hintergrund: Hyaluronan synthase 1 is an enzyme that in humans is encoded by the HAS1 gene. This gene is mapped to 19q13.41. Hyaluronan or hyaluronic acid (HA) is a high molecular weight unbranched polysaccharide synthesized by a wide variety of organisms from bacteria to mammals, and is a constituent of the extracellular matrix. It consists of alternating glucuronic acid and N-acetylglucosamine residues that are linked by beta-1-3 and beta-1-4 glycosidic bonds. It serves a variety of functions, including space filling, lubrication of joints, and provision of a matrix through which cells can migrate. HA is actively produced during wound healing and tissue repair to provide a framework for ingrowth of blood vessels and fibroblasts. AS1 is a member of the newly identified vertebrate gene family encoding putative hyaluronan synthases, and its amino acid sequence shows significant homology to the hasA gene product of Streptococcus pyogenes, a glycosaminoglycan synthetase (DG42) from Xenopus laevis, and a recently described murine hyaluronan synthase.

UniProt: Q92839

Pathways: Glycosaminoglycan Metabolic Process