Fibrinogen beta Chain Antikörper

Produktnummer ABIN7880786

Dieser Maus Monoklonal Antikörper detektiert spezifisch Fibrinogen beta Chain in WB und IHC (p). Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für Fibrinogen beta Chain Antikörper (ABIN7880786)

Target: Fibrinogen beta Chain (FGB)

Reaktivität: Human

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser Fibrinogen beta Chain Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Klon: 6D12

Produktdetails anti-Fibrinogen beta Chain Antikörper

Verwendungszweck: FGB Antibody / Fibrinogen beta chain

Sequenz: TNLRVLRSIL ENLRSKIQKL ESDVSAQMEY CRT

Aufreinigung: Affinity purified

Immunogen: Amino acids TNLRVLRSILENLRSKIQKLESDVSAQMEYCRT from the human protein were used as the immunogen for the FGB antibody.

Isotyp: IgG2b

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the FGB antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the FGB antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu Fibrinogen beta Chain

Target: Fibrinogen beta Chain (FGB)

Andere Bezeichnung: FGB

Hintergrund: Fibrinogen beta chain, mapped to 4q31.3, is also known as FGB. The protein encoded by this gene is the beta component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in this gene lead to several disorders, including afibrinogenemia, dysfibrinogenemia, hypodysfibrinogenemia and thrombotic tendency. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

UniProt: P02675