TMEM166 Antikörper

Produktnummer ABIN7880761

Der Kaninchen Polyklonal anti-TMEM166 Antikörper (ABIN7880761) detektiert spezifisch TMEM166 in WB, FACS und IHC (p). Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für TMEM166 Antikörper (ABIN7880761)

Target: TMEM166 (FAM176A) (Family with Sequence Similarity 176, Member A (FAM176A))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMEM166 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Produktdetails anti-TMEM166 Antikörper

Verwendungszweck: TMEM166 Antibody / EVA1A

Sequenz: MRLPLSHSPE HVEMALLSNI LAAYSFVSEN PERA

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids MRLPLSHSPEHVEMALLSNILAAYSFVSENPERA from the human protein were used as the immunogen for the TMEM166 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the TMEM166 antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the TMEM166 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu TMEM166

Target: TMEM166 (FAM176A) (Family with Sequence Similarity 176, Member A (FAM176A))

Andere Bezeichnung: TMEM166

Hintergrund: Eva-1 homolog A (C. elegans) is a protein that in humans is encoded by the EVA1A gene. It belongs to the FAM176 family. This gene is mapped to 2p12. EVA1A, also called TMEM166, acts as a regulator of programmed cell death, mediating both autophagy and apoptosis.

UniProt: Q9H8M9