TMEM166 Antikörper (N-Term)

Produktnummer ABIN635222

Produktdetails anti-TMEM166 Antikörper

Target: TMEM166 (FAM176A) (Family with Sequence Similarity 176, Member A (FAM176A))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMEM166 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TMEM166 antibody was raised against the N terminal Of Tmem166

Aufreinigung: Affinity purified

Immunogen: TMEM166 antibody was raised using the N terminal Of Tmem166 corresponding to a region with amino acids RLPLSHSPEHVEMALLSNILAAYSFVSENPERAALYFVSGVCIGLVLTLA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMEM166 Blocking Peptide, catalog no. 33R-8044, is also available for use as a blocking control in assays to test for specificity of this TMEM166 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM166 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMEM166

Target: TMEM166 (FAM176A) (Family with Sequence Similarity 176, Member A (FAM176A))

Andere Bezeichnung: TMEM166 (FAM176A Produkte)

Synonyme: Fam176a antikoerper, RGD1559797 antikoerper, Tmem166 antikoerper, FAM176A antikoerper, TMEM166 antikoerper, BC014699 antikoerper, eva-1 homolog A, regulator of programmed cell death antikoerper, eva-1 homolog A (C. elegans) antikoerper, Eva1a antikoerper, EVA1A antikoerper

Hintergrund: TMEM166 belongs to the FAM176 family. It acts as a regulator of programmed cell death, mediating both autophagy and apoptosis.

Molekulargewicht: 17 kDa (MW of target protein)