EEF2 Antikörper

Produktnummer ABIN7880744

Dieser Maus Monoklonal Antikörper detektiert spezifisch EEF2 in WB, IF, IHC (p) und FACS. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für EEF2 Antikörper (ABIN7880744)

Target: EEF2 (Eukaryotic Translation Elongation Factor 2 (EEF2))

Reaktivität: Human, Maus, Ratte

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser EEF2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Flow Cytometry (FACS)

Klon: 5F5

Produktdetails anti-EEF2 Antikörper

Verwendungszweck: EEF2 Antibody / Elongation factor 2

Sequenz: QTETVLRQAI AERIKPVLMM NKMDRALLEL QLEPEELYQT FQR

Aufreinigung: Affinity purified

Immunogen: Amino acids QTETVLRQAIAERIKPVLMMNKMDRALLELQLEPEELYQTFQR from the human protein were used as the immunogen for the EEF2 antibody.

Isotyp: IgG1

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the EEF2 antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the EEF2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu EEF2

Target: EEF2 (Eukaryotic Translation Elongation Factor 2 (EEF2))

Andere Bezeichnung: EEF2

Hintergrund: Eukaryotic elongation factor 2 is a protein that in humans is encoded by the EEF2 gene. This gene encodes a member of the GTP-binding translation elongation factor family. This protein is an essential factor for protein synthesis. It promotes the GTP-dependent translocation of the nascent protein chain from the A-site to the P-site of the ribosome. This protein is completely inactivated by EF-2 kinase phosporylation.

UniProt: P13639

Pathways: AMPK Signaling