EEF2 Antikörper

Produktnummer ABIN7880743

Der Kaninchen Polyklonal anti-EEF2 Antikörper (ABIN7880743) detektiert spezifisch EEF2 in WB, IF, IHC (p) und FACS. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus, Ratte und Affe.

Kurzübersicht für EEF2 Antikörper (ABIN7880743)

Target: EEF2 (Eukaryotic Translation Elongation Factor 2 (EEF2))

Reaktivität: Human, Maus, Ratte, Affe

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EEF2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Flow Cytometry (FACS)

Produktdetails anti-EEF2 Antikörper

Verwendungszweck: Elongation factor 2 Antibody / EEF2

Sequenz: QTETVLRQAI AERIKPVLMM NKMDRALLEL QLEPEELYQT FQR

Aufreinigung: Affinity purified

Immunogen: Amino acids QTETVLRQAIAERIKPVLMMNKMDRALLELQLEPEELYQTFQR from the human protein were used as the immunogen for the Elongation factor 2 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the Elongation factor 2 antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the Elongation factor 2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu EEF2

Target: EEF2 (Eukaryotic Translation Elongation Factor 2 (EEF2))

Andere Bezeichnung: Elongation factor 2

Hintergrund: Eukaryotic elongation factor 2 is a protein that in humans is encoded by the EEF2 gene. This gene encodes a member of the GTP-binding translation elongation factor family. This protein is an essential factor for protein synthesis. It promotes the GTP-dependent translocation of the nascent protein chain from the A-site to the P-site of the ribosome. This protein is completely inactivated by EF-2 kinase phosporylation.

UniProt: P13639

Pathways: AMPK Signaling