CRB1 Antikörper

Produktnummer ABIN7880515

Der Kaninchen Polyklonal anti-CRB1 Antikörper (ABIN7880515) detektiert spezifisch CRB1 in WB, IHC (p) und FACS. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus und Ratte.

Kurzübersicht für CRB1 Antikörper (ABIN7880515)

Target: CRB1 (Crumbs Homolog 1 (CRB1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CRB1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Flow Cytometry (FACS)

Produktdetails anti-CRB1 Antikörper

Verwendungszweck: CRB1 Antibody

Sequenz: FRTRDANVII LHAEKEPEFL NISIQDSRLF FQLQ

Aufreinigung: Affinity purified

Immunogen: Amino acids FRTRDANVIILHAEKEPEFLNISIQDSRLFFQLQ from the human protein were used as the immunogen for the CRB1 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the CRB1 antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: Store the CRB1 antibody at -20oC.

Details zu CRB1

Target: CRB1 (Crumbs Homolog 1 (CRB1))

Andere Bezeichnung: CRB1

Hintergrund: Crumbs homolog 1 is a protein that in humans is encoded by the CRB1 gene. This gene encodes a protein which is similar to the Drosophila crumbs protein and localizes to the inner segment of mammalian photoreceptors. In Drosophila crumbs localizes to the stalk of the fly photoreceptor and may be a component of the molecular scaffold that controls proper development of polarity in the eye. Mutations in this gene are associated with a severe form of retinitis pigmentosa, RP12, and with Leber congenital amaurosis. Alternate splicing results in multiple transcript variants, some protein coding and some non-protein coding.

UniProt: P82279

Pathways: Notch Signalweg