CHM Antikörper

Produktnummer ABIN7880414

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch CHM in WB, IF, FACS und IHC (p). Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für CHM Antikörper (ABIN7880414)

Target: CHM (Choroideremia (Rab Escort Protein 1) (CHM))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CHM Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunofluorescence (IF), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Produktdetails anti-CHM Antikörper

Verwendungszweck: CHM Antibody / Choroideremia protein

Sequenz: QDQILENEEA IALSRKDKTI QHVEVFCYAS QDLHED

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids QDQILENEEAIALSRKDKTIQHVEVFCYASQDLHED from the human protein were used as the immunogen for the CHM antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the CHM antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the CHM antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu CHM

Target: CHM (Choroideremia (Rab Escort Protein 1) (CHM))

Andere Bezeichnung: CHM

Hintergrund: Rab escort protein 1 (REP1) also known as Rab proteins geranylgeranyltransferase component A 1, and Choroideremia protein, is an enzyme that in humans is encoded by the CHM gene. It is mapped to Xq21.2. This gene encodes component A of the RAB geranylgeranyl transferase holoenzyme. In the dimeric holoenzyme, this subunit binds unprenylated Rab GTPases and then presents them to the catalytic Rab GGTase subunit for the geranylgeranyl transfer reaction. Rab GTPases need to be geranylgeranyled on either one or two cysteine residues in their C-terminus to localize to the correct intracellular membrane. Mutations in this gene are a cause of choroideremia, also known as tapetochoroidal dystrophy (TCD). This X-linked disease is characterized by progressive dystrophy of the choroid, retinal pigment epithelium and retina. Alternatively spliced transcript variants have been found for this gene.

UniProt: P24386

Pathways: Sensory Perception of Sound