ABCC2 Antikörper

Produktnummer ABIN7880022

Der Kaninchen Polyklonal anti-ABCC2 Antikörper wird verwendet zum Nachweis von ABCC2 in Proben von Human. Er wurde validiert für WB und IHC (p).

Kurzübersicht für ABCC2 Antikörper (ABIN7880022)

Target: ABCC2 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 2 (ABCC2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ABCC2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Produktdetails anti-ABCC2 Antikörper

Verwendungszweck: MRP2 Antibody / Multidrug resistance-associated protein 2 / ABCC2

Sequenz: AIRHDCNFDK AMQFSEASFT WEHDSEATVR DVNLD

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids AIRHDCNFDKAMQFSEASFTWEHDSEATVRDVNLD from the human protein were used as the immunogen for the MRP2 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the MRP2 antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the MRP2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu ABCC2

Target: ABCC2 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 2 (ABCC2))

Andere Bezeichnung: MRP2

Hintergrund: Multidrug resistance-associated protein 2 (MRP2), also called canalicular multispecific organic anion transporter 1 (cMOAT) or ATP-binding cassette sub-family C member 2 (ABCC2), is a protein that in humans is encoded by the ABCC2 gene. The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein is expressed in the canalicular (apical) part of the hepatocyte and functions in biliary transport. Substrates include anticancer drugs such as vinblastine, therefore, this protein appears to contribute to drug resistance in mammalian cells. Several different mutations in this gene have been observed in patients with Dubin-Johnson syndrome (DJS), an autosomal recessive disorder characterized by conjugated hyperbilirubinemia.

UniProt: Q92887

Pathways: Hormone Transport